LOCUS BT007068 462 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens guanine nucleotide binding protein (G protein), gamma 10 mRNA, complete cds. ACCESSION BT007068 VERSION BT007068.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 462) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 462) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..462 /db_xref="H-InvDB:HIT000099988" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00675X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..462 /codon_start=1 /product="guanine nucleotide binding protein (G protein), gamma 10" /protein_id="AAP35731.1" /translation="MGAPLLSPGWGAGAAGRRWWMLLAPLLPALLLVRPAGALVEGLY CGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFL LVATAYETLKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL" BASE COUNT 62 a 153 c 172 g 75 t ORIGIN 1 atgggggcgc cgctgctctc tcccggctgg ggagccgggg ctgccggccg gcgctggtgg 61 atgctgctgg cgcccctgct gccggcgctg ctgctggtgc ggcccgcggg ggccctggtg 121 gaggggctct actgcggcac gcgggactgc tacgaggtgc tgggcgtgag ccgctcggcg 181 ggcaaggcgg agatcgcgcg ggcctaccgc cagctggccc ggcgctacca ccctgaccgc 241 taccggcccc agcccggaga cgagggcccc gggcggacgc cgcagagcgc cgaggaggct 301 ttcctgctgg tggcaaccgc ctacgagaca ctcaaggtct ctcaggcagc tgcagagctt 361 caacagtact gtatgcagaa tgcctgcaag gatgccctgc tggtgggtgt tccagctgga 421 agtaacccct tccgggagcc tagatcctgt gctttactct ag //