LOCUS BT007044 396 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens melanoma inhibitory activity mRNA, complete cds. ACCESSION BT007044 VERSION BT007044.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 396) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 396) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..396 /db_xref="H-InvDB:HIT000099964" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00324X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..396 /codon_start=1 /product="melanoma inhibitory activity" /protein_id="AAP35693.1" /translation="MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHP ISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGY FPSSIVREDQTLKPGKVDVKTDKWDFYCQ" BASE COUNT 71 a 111 c 121 g 93 t ORIGIN 1 atggcccggt ccctggtgtg ccttggtgtc atcatcttgc tgtctgcctt ctccggacct 61 ggtgtcaggg gtggtcctat gcccaagctg gctgaccgga agctgtgtgc ggaccaggag 121 tgcagccacc ctatctccat ggctgtggcc cttcaggact acatggcccc cgactgccga 181 ttcctgacca ttcaccgggg ccaagtggtg tatgtcttct ccaagctgaa gggccgtggg 241 cggctcttct ggggaggcag cgttcaggga gattactatg gagatctggc tgctcgcctg 301 ggctatttcc ccagtagcat tgtccgagag gaccagaccc tgaaacctgg caaagtcgat 361 gtgaagacag acaaatggga tttctactgc cagtag //