LOCUS       BT007044                 396 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens melanoma inhibitory activity mRNA, complete cds.
ACCESSION   BT007044
VERSION     BT007044.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 396)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 396)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..396
                     /db_xref="H-InvDB:HIT000099964"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00324X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..396
                     /codon_start=1
                     /product="melanoma inhibitory activity"
                     /protein_id="AAP35693.1"
                     /translation="MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHP
                     ISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGY
                     FPSSIVREDQTLKPGKVDVKTDKWDFYCQ"
BASE COUNT           71 a          111 c          121 g           93 t
ORIGIN      
        1 atggcccggt ccctggtgtg ccttggtgtc atcatcttgc tgtctgcctt ctccggacct
       61 ggtgtcaggg gtggtcctat gcccaagctg gctgaccgga agctgtgtgc ggaccaggag
      121 tgcagccacc ctatctccat ggctgtggcc cttcaggact acatggcccc cgactgccga
      181 ttcctgacca ttcaccgggg ccaagtggtg tatgtcttct ccaagctgaa gggccgtggg
      241 cggctcttct ggggaggcag cgttcaggga gattactatg gagatctggc tgctcgcctg
      301 ggctatttcc ccagtagcat tgtccgagag gaccagaccc tgaaacctgg caaagtcgat
      361 gtgaagacag acaaatggga tttctactgc cagtag
//