LOCUS BT007041 444 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) mRNA, complete cds. ACCESSION BT007041 VERSION BT007041.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 444) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 444) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..444 /db_xref="H-InvDB:HIT000099961" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00321X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..444 /codon_start=1 /product="ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)" /protein_id="AAP35690.1" /translation="MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSA YQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKV LLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM" BASE COUNT 141 a 97 c 83 g 123 t ORIGIN 1 atggcgctga agaggattca gaaagaattg agtgatctac agcgcgatcc acctgctcac 61 tgttcagctg gacctgtggg agatgacttg ttccactggc aagccactat tatggggcct 121 cctgatagcg catatcaagg tggagtcttc tttctcactg tacattttcc gacagattat 181 ccttttaaac caccaaagat tgctttcaca acaaaaattt accatccaaa cataaacagt 241 aatggaagta tttgtctcga tattctgagg tcacaatggt caccagctct gactgtatca 301 aaagttttat tgtccatatg ttctctactt tgtgatccta atccagatga ccccttagta 361 ccagatattg cacaaatcta taaatcagac aaagaaaaat acaacagaca tgcaagagaa 421 tggactcaga aatatgcaat gtag //