LOCUS       BT007031                 486 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens TAF12 RNA polymerase II, TATA box binding protein
            (TBP)-associated factor, 20kDa mRNA, complete cds.
ACCESSION   BT007031
VERSION     BT007031.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 486)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 486)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..486
                     /db_xref="H-InvDB:HIT000099951"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00335X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..486
                     /codon_start=1
                     /product="TAF12 RNA polymerase II, TATA box binding
                     protein (TBP)-associated factor, 20kDa"
                     /protein_id="AAP35678.1"
                     /translation="MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTP
                     GAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQL
                     ARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTK
                     K"
BASE COUNT          150 a          117 c          121 g           98 t
ORIGIN      
        1 atgaaccagt ttggcccctc agccctaatc aacctctcca atttctcatc cataaaaccg
       61 gaaccagcca gcacccctcc acaaggctcc atggccaata gtactgcagt ggtaaagata
      121 ccaggcactc ctggggcagg aggtcgtctt agccctgaaa acaatcaggt attgaccaag
      181 aagaaattac aggacttagt aagagaagtg gatcctaatg agcagttgga tgaagatgtg
      241 gaggagatgc tgctgcagat tgctgatgat tttatcgaga gtgtggtgac agcagcctgt
      301 cagcttgcgc ggcatcgcaa gtctagcacc ctggaggtga aagatgtcca gctgcattta
      361 gagcgccagt ggaacatgtg gatcccagga tttggctctg aagaaatccg accctacaaa
      421 aaagcttgca ccacagaagc tcacaaacag agaatggcat tgatccggaa aacaaccaag
      481 aaatag
//