LOCUS BT007031 486 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa mRNA, complete cds. ACCESSION BT007031 VERSION BT007031.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 486) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 486) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..486 /db_xref="H-InvDB:HIT000099951" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00335X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..486 /codon_start=1 /product="TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa" /protein_id="AAP35678.1" /translation="MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTP GAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQL ARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTK K" BASE COUNT 150 a 117 c 121 g 98 t ORIGIN 1 atgaaccagt ttggcccctc agccctaatc aacctctcca atttctcatc cataaaaccg 61 gaaccagcca gcacccctcc acaaggctcc atggccaata gtactgcagt ggtaaagata 121 ccaggcactc ctggggcagg aggtcgtctt agccctgaaa acaatcaggt attgaccaag 181 aagaaattac aggacttagt aagagaagtg gatcctaatg agcagttgga tgaagatgtg 241 gaggagatgc tgctgcagat tgctgatgat tttatcgaga gtgtggtgac agcagcctgt 301 cagcttgcgc ggcatcgcaa gtctagcacc ctggaggtga aagatgtcca gctgcattta 361 gagcgccagt ggaacatgtg gatcccagga tttggctctg aagaaatccg accctacaaa 421 aaagcttgca ccacagaagc tcacaaacag agaatggcat tgatccggaa aacaaccaag 481 aaatag //