LOCUS BT006997 633 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens regulator of G-protein signalling 17 mRNA, complete cds. ACCESSION BT006997 VERSION BT006997.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 633) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 633) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..633 /db_xref="H-InvDB:HIT000099917" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00352X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..633 /codon_start=1 /product="regulator of G-protein signalling 17" /protein_id="AAP35643.1" /translation="MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVR NEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFL RTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVIN RNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES" BASE COUNT 206 a 128 c 140 g 159 t ORIGIN 1 atgcgaaaaa ggcagcagtc ccaaaatgaa ggaacacctg ccgtgtctca agctcctgga 61 aaccagaggc ccaacaacac ctgttgcttt tgttggtgct gttgttgcag ctgctcctgc 121 ctcactgtga ggaatgaaga aagaggggaa aatgcgggaa gacccacaca cactacaaaa 181 atggagagta tccaggtcct agaggaatgc caaaacccca ctgcagagga agtcttgtcc 241 tggtctcaaa attttgacaa gatgatgaag gccccagcag gaagaaacct tttcagagag 301 ttcctccgaa cagaatacag tgaagagaac ctacttttct ggcttgcttg tgaagactta 361 aagaaggagc agaacaaaaa agtaattgaa gaaaaggcta ggatgatata tgaagattac 421 atttctatac tatcaccaaa agaggtcagt cttgattctc gagttagaga ggtgatcaat 481 agaaatctgt tggatcccaa tcctcacatg tatgaagatg cccaacttca gatatatact 541 ttaatgcaca gagattcttt tccaaggttt ttgaactctc aaatttataa gtcatttgtt 601 gaaagtactg ctggctcttc ttctgaatct tag //