LOCUS       BT006997                 633 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens regulator of G-protein signalling 17 mRNA, complete
            cds.
ACCESSION   BT006997
VERSION     BT006997.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 633)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 633)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..633
                     /db_xref="H-InvDB:HIT000099917"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00352X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..633
                     /codon_start=1
                     /product="regulator of G-protein signalling 17"
                     /protein_id="AAP35643.1"
                     /translation="MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVR
                     NEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFL
                     RTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVIN
                     RNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES"
BASE COUNT          206 a          128 c          140 g          159 t
ORIGIN      
        1 atgcgaaaaa ggcagcagtc ccaaaatgaa ggaacacctg ccgtgtctca agctcctgga
       61 aaccagaggc ccaacaacac ctgttgcttt tgttggtgct gttgttgcag ctgctcctgc
      121 ctcactgtga ggaatgaaga aagaggggaa aatgcgggaa gacccacaca cactacaaaa
      181 atggagagta tccaggtcct agaggaatgc caaaacccca ctgcagagga agtcttgtcc
      241 tggtctcaaa attttgacaa gatgatgaag gccccagcag gaagaaacct tttcagagag
      301 ttcctccgaa cagaatacag tgaagagaac ctacttttct ggcttgcttg tgaagactta
      361 aagaaggagc agaacaaaaa agtaattgaa gaaaaggcta ggatgatata tgaagattac
      421 atttctatac tatcaccaaa agaggtcagt cttgattctc gagttagaga ggtgatcaat
      481 agaaatctgt tggatcccaa tcctcacatg tatgaagatg cccaacttca gatatatact
      541 ttaatgcaca gagattcttt tccaaggttt ttgaactctc aaatttataa gtcatttgtt
      601 gaaagtactg ctggctcttc ttctgaatct tag
//