LOCUS BT006981 726 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens B-cell receptor-associated protein BAP29 mRNA, complete cds. ACCESSION BT006981 VERSION BT006981.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 726) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 726) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..726 /db_xref="H-InvDB:HIT000099901" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00362X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..726 /codon_start=1 /product="B-cell receptor-associated protein BAP29" /protein_id="AAP35627.1" /translation="MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKI ATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQR NLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKR ILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKE YDQLLKEHSELQDRLERGNKKRL" BASE COUNT 257 a 127 c 141 g 201 t ORIGIN 1 atgacactcc aatgggctgc agtggcaacc tttctttatg ccgaaatagg actcatttta 61 atcttctgcc taccttttat tcctcctcag agatggcaga agattttttc atttaatgtc 121 tggggtaaaa ttgcaacttt ttggaacaag gctttcctta ccattatcat cctattgatt 181 gttctatttc tagatgctgt gagagaagta aggaaatatt cctcagttca taccattgag 241 aagagctcca ccagcagacc tgatgcctat gaacacacac agatgaaact ttttaggtct 301 caaagaaatc tttacatttc tggattttcc ctattttttt ggctagtttt gagacgtctg 361 gttacgctta ttactcaact ggcaaaagaa ctgtcaaaca aaggtgtact taaaactcaa 421 gcagaaaata ctaacaaggc tgccaaaaaa tttatggaag aaaacgaaaa actaaaaagg 481 attttgaaaa gccatggtaa agatgaagaa tgtgttttgg aagcagaaaa taaaaaacta 541 gtagaagacc aggagaaact gaaaactgaa ttaaggaaga cttcagatgc cctttctaag 601 gcacaaaatg atgtgatgga aatgaagatg cagtcagaga gactttcgaa agaatatgat 661 caactcctga aagaacactc tgaacttcag gatcgtttag aaagaggcaa caagaaaaga 721 ctgtag //