LOCUS       BT006981                 726 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens B-cell receptor-associated protein BAP29 mRNA,
            complete cds.
ACCESSION   BT006981
VERSION     BT006981.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 726)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 726)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..726
                     /db_xref="H-InvDB:HIT000099901"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00362X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..726
                     /codon_start=1
                     /product="B-cell receptor-associated protein BAP29"
                     /protein_id="AAP35627.1"
                     /translation="MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKI
                     ATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQR
                     NLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKR
                     ILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKE
                     YDQLLKEHSELQDRLERGNKKRL"
BASE COUNT          257 a          127 c          141 g          201 t
ORIGIN      
        1 atgacactcc aatgggctgc agtggcaacc tttctttatg ccgaaatagg actcatttta
       61 atcttctgcc taccttttat tcctcctcag agatggcaga agattttttc atttaatgtc
      121 tggggtaaaa ttgcaacttt ttggaacaag gctttcctta ccattatcat cctattgatt
      181 gttctatttc tagatgctgt gagagaagta aggaaatatt cctcagttca taccattgag
      241 aagagctcca ccagcagacc tgatgcctat gaacacacac agatgaaact ttttaggtct
      301 caaagaaatc tttacatttc tggattttcc ctattttttt ggctagtttt gagacgtctg
      361 gttacgctta ttactcaact ggcaaaagaa ctgtcaaaca aaggtgtact taaaactcaa
      421 gcagaaaata ctaacaaggc tgccaaaaaa tttatggaag aaaacgaaaa actaaaaagg
      481 attttgaaaa gccatggtaa agatgaagaa tgtgttttgg aagcagaaaa taaaaaacta
      541 gtagaagacc aggagaaact gaaaactgaa ttaaggaaga cttcagatgc cctttctaag
      601 gcacaaaatg atgtgatgga aatgaagatg cagtcagaga gactttcgaa agaatatgat
      661 caactcctga aagaacactc tgaacttcag gatcgtttag aaagaggcaa caagaaaaga
      721 ctgtag
//