LOCUS BT006973 357 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens hypothetical protein MGC4175 mRNA, complete cds. ACCESSION BT006973 VERSION BT006973.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 357) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 357) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..357 /db_xref="H-InvDB:HIT000099893" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00383X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..357 /codon_start=1 /product="hypothetical protein MGC4175" /protein_id="AAP35619.1" /translation="MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILV TLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSI IMLCICANLYFHDVGR" BASE COUNT 94 a 75 c 72 g 116 t ORIGIN 1 atggaggact ttgctaccag gacctacggc accagtggcc tggacaacag acctctgttt 61 ggggagacgt ccgccaagga tcgaatcatc aatttagttg ttggcagctt aacatcctta 121 ttgattctag taacgctgat aagtgctttt gttttccctc aactacctcc aaaaccgttg 181 aatatattct ttgctgtctg catctctttg agtagtatta ctgcctgcat acttatctac 241 tggtatcgac aaggagactt agaaccgaaa tttagaaagc taatttacta tatcatattt 301 tctatcatca tgttgtgtat atgtgcaaac ctgtacttcc atgatgtggg aaggtag //