LOCUS BT006949 510 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens benzodiazapine receptor (peripheral) mRNA, complete cds. ACCESSION BT006949 VERSION BT006949.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 510) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 510) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..510 /db_xref="H-InvDB:HIT000099869" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00128X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..510 /codon_start=1 /product="benzodiazapine receptor (peripheral)" /protein_id="AAP35595.1" /translation="MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHP PHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGA RQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHG WHGGRRLPE" BASE COUNT 65 a 174 c 173 g 98 t ORIGIN 1 atggccccgc cctgggtgcc cgccatgggc ttcacgctgg cgcccagcct ggggtgcttc 61 gtgggctccc gctttgtcca cggcgagggt ctccgctggt acgccggcct gcagaagccc 121 tcgtggcacc cgccccactg ggtgctgggc cctgtctggg gcacgctcta ctcagccatg 181 gggtacggct cctacctggt ctggaaagag ctgggaggct tcacagagaa ggctgtggtt 241 cccctgggcc tctacactgg gcagctggcc ctgaactggg catggccccc catcttcttt 301 ggtgcccgac aaatgggctg ggccttggtg gatctcctgc tggtcagtgg ggcggcggca 361 gccactaccg tggcctggta ccaggtgagc ccgctggccg cccgcctgct ctacccctac 421 ctggcctggc tggccttcgc gaccacactc aactactgcg tatggcggga caaccatggc 481 tggcatgggg gacggcggct gccagagtag //