LOCUS       BT006949                 510 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens benzodiazapine receptor (peripheral) mRNA, complete
            cds.
ACCESSION   BT006949
VERSION     BT006949.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 510)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 510)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..510
                     /db_xref="H-InvDB:HIT000099869"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00128X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..510
                     /codon_start=1
                     /product="benzodiazapine receptor (peripheral)"
                     /protein_id="AAP35595.1"
                     /translation="MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHP
                     PHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGA
                     RQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHG
                     WHGGRRLPE"
BASE COUNT           65 a          174 c          173 g           98 t
ORIGIN      
        1 atggccccgc cctgggtgcc cgccatgggc ttcacgctgg cgcccagcct ggggtgcttc
       61 gtgggctccc gctttgtcca cggcgagggt ctccgctggt acgccggcct gcagaagccc
      121 tcgtggcacc cgccccactg ggtgctgggc cctgtctggg gcacgctcta ctcagccatg
      181 gggtacggct cctacctggt ctggaaagag ctgggaggct tcacagagaa ggctgtggtt
      241 cccctgggcc tctacactgg gcagctggcc ctgaactggg catggccccc catcttcttt
      301 ggtgcccgac aaatgggctg ggccttggtg gatctcctgc tggtcagtgg ggcggcggca
      361 gccactaccg tggcctggta ccaggtgagc ccgctggccg cccgcctgct ctacccctac
      421 ctggcctggc tggccttcgc gaccacactc aactactgcg tatggcggga caaccatggc
      481 tggcatgggg gacggcggct gccagagtag
//