LOCUS BT006945 261 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens cytochrome c oxidase subunit VIb mRNA, complete cds. ACCESSION BT006945 VERSION BT006945.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 261) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 261) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..261 /db_xref="H-InvDB:HIT000099865" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00409X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..261 /codon_start=1 /product="cytochrome c oxidase subunit VIb" /protein_id="AAP35591.1" /translation="MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAM TAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI" BASE COUNT 72 a 75 c 68 g 46 t ORIGIN 1 atggcggaag acatggagac caaaatcaag aactacaaga ccgccccttt tgacagccgc 61 ttccccaacc agaaccagac tagaaactgc tggcagaact acctggactt ccaccgctgt 121 cagaaggcaa tgaccgctaa aggaggcgat atctctgtgt gcgaatggta ccagcgtgtg 181 taccagtccc tctgccccac atcctgggtc acagactggg atgagcaacg ggctgaaggc 241 acgtttcccg ggaagatcta g //