LOCUS       BT006890                 498 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens chorionic gonadotropin, beta polypeptide mRNA,
            complete cds.
ACCESSION   BT006890
VERSION     BT006890.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 498)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 498)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..498
                     /db_xref="H-InvDB:HIT000099810_06"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00458X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..498
                     /codon_start=1
                     /product="chorionic gonadotropin, beta polypeptide"
                     /protein_id="AAP35536.1"
                     /translation="MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCP
                     VCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSY
                     AVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDT
                     PILPQ"
BASE COUNT           75 a          192 c          139 g           92 t
ORIGIN      
        1 atggagatgt tccaggggct gctgctgttg ctgctgctga gcatgggcgg gacatgggca
       61 tccaaggagc cgcttcggcc acggtgccgc cccatcaatg ccaccctggc tgtggagaag
      121 gagggctgcc ccgtgtgcat caccgtcaac accaccatct gtgccggcta ctgccccacc
      181 atgacccgcg tgctgcaggg ggtcctgccg gccctgcctc aggtggtgtg caactaccgc
      241 gatgtgcgct tcgagtccat ccggctccct ggctgcccgc gcggcgtgaa ccccgtggtc
      301 tcctacgccg tggctctcag ctgtcaatgt gcactctgcc gccgcagcac cactgactgc
      361 gggggtccca aggaccaccc cttgacctgt gatgaccccc gcttccagga ctcctcttcc
      421 tcaaaggccc ctccccccag ccttccaagt ccatcccgac tcccggggcc ctcggacacc
      481 ccgatcctcc cacaatag
//