LOCUS BT006890 498 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens chorionic gonadotropin, beta polypeptide mRNA, complete cds. ACCESSION BT006890 VERSION BT006890.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 498) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 498) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..498 /db_xref="H-InvDB:HIT000099810_06" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00458X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..498 /codon_start=1 /product="chorionic gonadotropin, beta polypeptide" /protein_id="AAP35536.1" /translation="MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCP VCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSY AVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDT PILPQ" BASE COUNT 75 a 192 c 139 g 92 t ORIGIN 1 atggagatgt tccaggggct gctgctgttg ctgctgctga gcatgggcgg gacatgggca 61 tccaaggagc cgcttcggcc acggtgccgc cccatcaatg ccaccctggc tgtggagaag 121 gagggctgcc ccgtgtgcat caccgtcaac accaccatct gtgccggcta ctgccccacc 181 atgacccgcg tgctgcaggg ggtcctgccg gccctgcctc aggtggtgtg caactaccgc 241 gatgtgcgct tcgagtccat ccggctccct ggctgcccgc gcggcgtgaa ccccgtggtc 301 tcctacgccg tggctctcag ctgtcaatgt gcactctgcc gccgcagcac cactgactgc 361 gggggtccca aggaccaccc cttgacctgt gatgaccccc gcttccagga ctcctcttcc 421 tcaaaggccc ctccccccag ccttccaagt ccatcccgac tcccggggcc ctcggacacc 481 ccgatcctcc cacaatag //