LOCUS BT006860 336 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens uridine monophosphate kinase mRNA, complete cds. ACCESSION BT006860 VERSION BT006860.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 336) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 336) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..336 /db_xref="H-InvDB:HIT000099780" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00481X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..336 /codon_start=1 /product="uridine monophosphate kinase" /protein_id="AAP35506.1" /translation="MKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFE EFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQ ASESSSRPH" BASE COUNT 89 a 87 c 88 g 72 t ORIGIN 1 atgaagcttt ttgtggatac agatgcggac acccggctct cacgcagagt attaagggac 61 atcagcgaga gaggcaggga tcttgagcag attttatctc agtacattac gttcgtcaag 121 cctgcctttg aggaattctg cttgccaaca aagaagtatg ctgatgtgat catccctaga 181 ggtgcagata atctggtggc catcaacctc atcgtgcagc acatccagga catcctgaat 241 ggagggccct ccaaacggca gaccaatggc tgtctcaacg gctacacccc ttcacgcaag 301 aggcaggcat cggagtccag cagcaggccg cattag //