LOCUS BT006848 636 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory) mRNA, complete cds. ACCESSION BT006848 VERSION BT006848.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 636) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 636) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..636 /db_xref="H-InvDB:HIT000099768" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00493X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..636 /codon_start=1 /product="tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory)" /protein_id="AAP35494.1" /translation="MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRA KVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQY LLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSK NECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP" BASE COUNT 139 a 190 c 182 g 125 t ORIGIN 1 atgacccctt ggctcgggct catcgtgctc ctgggcagct ggagcctggg ggactggggc 61 gccgaggcgt gcacatgctc gcccagccac ccccaggacg ccttctgcaa ctccgacatc 121 gtgatccggg ccaaggtggt ggggaagaag ctggtaaagg aggggccctt cggcacgctg 181 gtctacacca tcaagcagat gaagatgtac cgaggcttca ccaagatgcc ccatgtgcag 241 tacatccata cggaagcttc cgagagtctc tgtggcctta agctggaggt caacaagtac 301 cagtacctgc tgacaggtcg cgtctatgat ggcaagatgt acacggggct gtgcaacttc 361 gtggagaggt gggaccagct caccctctcc cagcgcaagg ggctgaacta tcggtatcac 421 ctgggttgta actgcaagat caagtcctgc tactacctgc cttgctttgt gacttccaag 481 aacgagtgtc tctggaccga catgctctcc aatttcggtt accctggcta ccagtccaaa 541 cactacgcct gcatccggca gaagggcggc tactgcagct ggtaccgagg atgggccccc 601 ccggataaaa gcatcatcaa tgccacagac ccctag //