LOCUS       BT006848                 636 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens tissue inhibitor of metalloproteinase 3 (Sorsby fundus
            dystrophy, pseudoinflammatory) mRNA, complete cds.
ACCESSION   BT006848
VERSION     BT006848.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 636)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 636)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..636
                     /db_xref="H-InvDB:HIT000099768"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00493X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..636
                     /codon_start=1
                     /product="tissue inhibitor of metalloproteinase 3 (Sorsby
                     fundus dystrophy, pseudoinflammatory)"
                     /protein_id="AAP35494.1"
                     /translation="MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRA
                     KVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQY
                     LLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSK
                     NECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP"
BASE COUNT          139 a          190 c          182 g          125 t
ORIGIN      
        1 atgacccctt ggctcgggct catcgtgctc ctgggcagct ggagcctggg ggactggggc
       61 gccgaggcgt gcacatgctc gcccagccac ccccaggacg ccttctgcaa ctccgacatc
      121 gtgatccggg ccaaggtggt ggggaagaag ctggtaaagg aggggccctt cggcacgctg
      181 gtctacacca tcaagcagat gaagatgtac cgaggcttca ccaagatgcc ccatgtgcag
      241 tacatccata cggaagcttc cgagagtctc tgtggcctta agctggaggt caacaagtac
      301 cagtacctgc tgacaggtcg cgtctatgat ggcaagatgt acacggggct gtgcaacttc
      361 gtggagaggt gggaccagct caccctctcc cagcgcaagg ggctgaacta tcggtatcac
      421 ctgggttgta actgcaagat caagtcctgc tactacctgc cttgctttgt gacttccaag
      481 aacgagtgtc tctggaccga catgctctcc aatttcggtt accctggcta ccagtccaaa
      541 cactacgcct gcatccggca gaagggcggc tactgcagct ggtaccgagg atgggccccc
      601 ccggataaaa gcatcatcaa tgccacagac ccctag
//