LOCUS BT006815 561 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens RAB, member of RAS oncogene family-like 4 mRNA, complete cds. ACCESSION BT006815 VERSION BT006815.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 561) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 561) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..561 /db_xref="H-InvDB:HIT000099735" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00514X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..561 /codon_start=1 /product="RAB, member of RAS oncogene family-like 4" /protein_id="AAP35461.1" /translation="MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDL VVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSK WLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENF EAPFHCLAKQFHQLYREKVEVFRALA" BASE COUNT 137 a 137 c 167 g 120 t ORIGIN 1 atggtgaagc tggcagccaa atgcatcctg gcaggagacc cagcagtggg caagaccgcc 61 ctggcacaga tcttccgcag tgatggagcc catttccaga aaagctacac cctgacaaca 121 ggaatggatt tggtggtgaa gacagtgcca gttcctgaca cgggagacag tgtggaactc 181 ttcatttttg actctgctgg caaggagctg ttttcggaaa tgctggataa attgtgggag 241 agtcccaatg tcttatgtct cgtctatgat gtgaccaatg aagaatcctt caacaactgc 301 agcaagtggc tggagaaggc tcggtcacag gctccaggca tctctctccc aggtgtttta 361 gttgggaaca agacagacct ggccggcaga cgagcagtgg actcagctga ggcccgggca 421 tgggcgctgg gccagggcct ggaatgtttt gaaacatccg tgaaagagat ggaaaacttc 481 gaagcccctt tccactgcct tgccaagcag ttccaccagc tgtaccggga gaaggtggag 541 gttttccggg ccctggcata g //