LOCUS       BT006813                 543 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens glucagon mRNA, complete cds.
ACCESSION   BT006813
VERSION     BT006813.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 543)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 543)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..543
                     /db_xref="H-InvDB:HIT000099733"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00512X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..543
                     /codon_start=1
                     /product="glucagon"
                     /protein_id="AAP35459.1"
                     /translation="MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDP
                     DQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGT
                     FTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILD
                     NLAARDFINWLIQTKITDRK"
BASE COUNT          160 a          116 c          136 g          131 t
ORIGIN      
        1 atgaaaagca tttactttgt ggctggatta tttgtaatgc tggtacaagg cagctggcaa
       61 cgttcccttc aagacacaga ggagaaatcc agatcattct cagcttccca ggcagaccca
      121 ctcagtgatc ctgatcagat gaacgaggac aagcgccatt cacagggcac attcaccagt
      181 gactacagca agtatctgga ctccaggcgt gcccaagatt ttgtgcagtg gttgatgaat
      241 accaagagga acaggaataa cattgccaaa cgtcacgatg aatttgagag acatgctgaa
      301 gggaccttta ccagtgatgt aagttcttat ttggaaggcc aagctgccaa ggaattcatt
      361 gcttggctgg tgaaaggccg aggaaggcga gatttcccag aagaggtcgc cattgttgaa
      421 gaacttggcc gcagacatgc tgatggttct ttctctgatg agatgaacac cattcttgat
      481 aatcttgccg ccagggactt tataaactgg ttgattcaga ccaaaatcac tgacaggaaa
      541 tag
//