LOCUS BT006813 543 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens glucagon mRNA, complete cds. ACCESSION BT006813 VERSION BT006813.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 543) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 543) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..543 /db_xref="H-InvDB:HIT000099733" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00512X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..543 /codon_start=1 /product="glucagon" /protein_id="AAP35459.1" /translation="MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDP DQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGT FTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILD NLAARDFINWLIQTKITDRK" BASE COUNT 160 a 116 c 136 g 131 t ORIGIN 1 atgaaaagca tttactttgt ggctggatta tttgtaatgc tggtacaagg cagctggcaa 61 cgttcccttc aagacacaga ggagaaatcc agatcattct cagcttccca ggcagaccca 121 ctcagtgatc ctgatcagat gaacgaggac aagcgccatt cacagggcac attcaccagt 181 gactacagca agtatctgga ctccaggcgt gcccaagatt ttgtgcagtg gttgatgaat 241 accaagagga acaggaataa cattgccaaa cgtcacgatg aatttgagag acatgctgaa 301 gggaccttta ccagtgatgt aagttcttat ttggaaggcc aagctgccaa ggaattcatt 361 gcttggctgg tgaaaggccg aggaaggcga gatttcccag aagaggtcgc cattgttgaa 421 gaacttggcc gcagacatgc tgatggttct ttctctgatg agatgaacac cattcttgat 481 aatcttgccg ccagggactt tataaactgg ttgattcaga ccaaaatcac tgacaggaaa 541 tag //