LOCUS BT006779 402 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens adaptor-related protein complex 1, sigma 1 subunit mRNA, complete cds. ACCESSION BT006779 VERSION BT006779.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 402) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 402) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..402 /db_xref="H-InvDB:HIT000099699" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00558X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..402 /codon_start=1 /product="adaptor-related protein complex 1, sigma 1 subunit" /protein_id="AAP35425.1" /translation="MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKP KMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELD IIFNFEKAYFILDEFLMGGDVQDTSTFPFSH" BASE COUNT 97 a 99 c 110 g 96 t ORIGIN 1 atgatgcggt tcatgctatt attcagccgg cagggaaaac tgcggctgca aaaatggtac 61 ctggccactt cggacaagga acggaagaag atggtgcgcg agctcatgca ggttgtcctg 121 gctcgaaagc ccaagatgtg cagcttcctg gagtggaggg acctcaaagt tgtctataag 181 agatatgcca gcctctactt ctgctgcgcc atcgagggcc aagacaatga gctcatcaca 241 ctggagctga tccaccgata cgtggagctc ttagacaaat actttggcag tgtgtgcgag 301 ctggacatca tcttcaactt tgagaaggcc tacttcatcc tggatgagtt tttgatgggg 361 ggggatgtcc aggacacctc cactttcccc ttttcccact ag //