LOCUS BT006756 552 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) mRNA, complete cds. ACCESSION BT006756 VERSION BT006756.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 552) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 552) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..552 /db_xref="H-InvDB:HIT000099676" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00560X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..552 /codon_start=1 /product="ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)" /protein_id="AAP35402.1" /translation="MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGT PYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLT NIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEG TGDSSSESSMSDFSEDEAQDMEL" BASE COUNT 169 a 119 c 132 g 132 t ORIGIN 1 atgtcatctc ccagtccggg caagaggcgg atggacacgg acgtggtcaa gctcatcgag 61 agtaaacatg aggttacgat cctgggagga cttaatgaat ttgtagtgaa gttttatgga 121 ccacaaggaa caccatatga aggcggagta tggaaagtta gagtggacct acctgataaa 181 taccctttca aatctccatc tataggattc atgaataaaa ttttccatcc caacattgat 241 gaagcgtcag gaactgtgtg tctagatgta attaatcaaa cttggacagc tctctatgat 301 cttaccaata tatttgagtc cttcctgcct cagttattgg cctatcctaa ccccatagat 361 cctctcaatg gtgacgctgc agccatgtac ctccaccgac cagaagaata caagcagaaa 421 attaaagagt acatccagaa atacgccacg gaggaggcgc tgaaagaaca ggaagagggt 481 accggggaca gctcatcgga gagctctatg tctgactttt ccgaagatga ggcccaggat 541 atggagttgt ag //