LOCUS       BT006756                 552 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
            mRNA, complete cds.
ACCESSION   BT006756
VERSION     BT006756.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 552)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 552)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..552
                     /db_xref="H-InvDB:HIT000099676"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00560X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..552
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2H (UBC8 homolog,
                     yeast)"
                     /protein_id="AAP35402.1"
                     /translation="MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGT
                     PYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLT
                     NIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEG
                     TGDSSSESSMSDFSEDEAQDMEL"
BASE COUNT          169 a          119 c          132 g          132 t
ORIGIN      
        1 atgtcatctc ccagtccggg caagaggcgg atggacacgg acgtggtcaa gctcatcgag
       61 agtaaacatg aggttacgat cctgggagga cttaatgaat ttgtagtgaa gttttatgga
      121 ccacaaggaa caccatatga aggcggagta tggaaagtta gagtggacct acctgataaa
      181 taccctttca aatctccatc tataggattc atgaataaaa ttttccatcc caacattgat
      241 gaagcgtcag gaactgtgtg tctagatgta attaatcaaa cttggacagc tctctatgat
      301 cttaccaata tatttgagtc cttcctgcct cagttattgg cctatcctaa ccccatagat
      361 cctctcaatg gtgacgctgc agccatgtac ctccaccgac cagaagaata caagcagaaa
      421 attaaagagt acatccagaa atacgccacg gaggaggcgc tgaaagaaca ggaagagggt
      481 accggggaca gctcatcgga gagctctatg tctgactttt ccgaagatga ggcccaggat
      541 atggagttgt ag
//