LOCUS BT006733 312 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens matrix Gla protein mRNA, complete cds. ACCESSION BT006733 VERSION BT006733.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 312) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 312) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..312 /db_xref="H-InvDB:HIT000099653" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00591X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..312 /codon_start=1 /product="matrix Gla protein" /protein_id="AAP35379.1" /translation="MKSLILLAILAALAVVTLCYESHESMESYELNPFINRRNANTFI SPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYFRKRRGA K" BASE COUNT 92 a 74 c 72 g 74 t ORIGIN 1 atgaagagcc tgatccttct tgccatcctg gccgccttag cggtagtaac tttgtgttat 61 gaatcacatg aaagcatgga atcttatgaa cttaatccct tcattaacag gagaaatgca 121 aataccttca tatcccctca gcagagatgg agagctaaag tccaagagag gatccgagaa 181 cgctctaagc ctgtccacga gctcaatagg gaagcctgtg atgactacag actttgcgaa 241 cgctacgcca tggtttatgg atacaatgct gcctataatc gctacttcag gaagcgccga 301 ggggccaaat ag //