LOCUS BT006728 483 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens BCL2-interacting killer (apoptosis-inducing) mRNA, complete cds. ACCESSION BT006728 VERSION BT006728.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 483) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 483) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..483 /db_xref="H-InvDB:HIT000099648" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00586X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..483 /codon_start=1 /product="BCL2-interacting killer (apoptosis-inducing)" /protein_id="AAP35374.1" /translation="MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMED FDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRD VLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK " BASE COUNT 91 a 137 c 150 g 105 t ORIGIN 1 atgtctgaag taagacccct ctccagagac atcttgatgg agaccctcct gtatgagcag 61 ctcctggaac ccccgaccat ggaggttctt ggcatgactg actctgaaga ggacctggac 121 cctatggagg acttcgattc tttggaatgc atggagggca gtgacgcatt ggccctgcgg 181 ctggcctgca tcggggacga gatggacgtg agcctcaggg ccccgcgcct ggcccagctc 241 tccgaggtgg ccatgcacag cctgggtctg gctttcatct acgaccagac tgaggacatc 301 agggatgttc ttagaagttt catggacggt ttcaccacac ttaaggagaa cataatgagg 361 ttctggagat ccccgaaccc cgggtcctgg gtgtcctgcg aacaggtgct gctggcgctg 421 ctgctgctgc tggcgctgct gctgccgctg ctcagcgggg gcctgcacct gctgctcaag 481 tag //