LOCUS BT006695 351 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa mRNA, complete cds. ACCESSION BT006695 VERSION BT006695.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 351) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 351) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..351 /db_xref="H-InvDB:HIT000099615" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00630X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..351 /codon_start=1 /product="NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa" /protein_id="AAP35341.1" /translation="MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAY RKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEP LVEEPPADQWKWPI" BASE COUNT 123 a 57 c 92 g 79 t ORIGIN 1 atggcgggtg tgctgaagaa gaccactggc cttgtgggat tggctgtgtg caatactcct 61 cacgagaggc taagaatatt gtacacaaag attcttgatg ttcttgagga aatccctaaa 121 aatgcagcat atagaaagta tacagaacag attacaaatg agaagctggc tatggttaaa 181 gcggaaccag atgttaaaaa attagaagac caacttcaag gcggtcaatt agaagaggtg 241 attcttcagg ctgaacatga actaaatctg gcaagaaaaa tgagggaatg gaaactatgg 301 gagccattag tggaagagcc tcctgccgat cagtggaaat ggccaatata g //