LOCUS       BT006690                 363 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens laminin, alpha 4 mRNA, complete cds.
ACCESSION   BT006690
VERSION     BT006690.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 363)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 363)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..363
                     /db_xref="H-InvDB:HIT000099610"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00625X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..363
                     /codon_start=1
                     /product="laminin, alpha 4"
                     /protein_id="AAP35336.1"
                     /translation="MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGR
                     QDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLE
                     SFTWARSVRKLEIKSFPL"
BASE COUNT           49 a          124 c          103 g           87 t
ORIGIN      
        1 atggctttga gctcagcctg gcgctcggtt ctgcctctgt ggctcctctg gagcgctgcc
       61 tgctcccgcg ccgcgtccgg ggacgacaac gcttttcctt ttgacattga agggagctca
      121 gcggttggca ggcaagaccc gcctgagacg agcgaacccc gcgtggctct gggacgcctg
      181 ccgcctgcgg ccgaggtaca gtgtccctgc cattgccacc ctgctggggc acctgcgccc
      241 ccgcgggctg tgccacactc gtccttctct ctctctccgc ctctttcctc tccccagtgc
      301 cttgagagtt tcacctgggc taggtcagtt cggaaacttg aaataaagag ttttcctttg
      361 tag
//