LOCUS BT006674 555 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ADP-ribosylation factor-like 2 mRNA, complete cds. ACCESSION BT006674 VERSION BT006674.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 555) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 555) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..555 /db_xref="H-InvDB:HIT000099594" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00633X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..555 /codon_start=1 /product="ADP-ribosylation factor-like 2" /protein_id="AAP35320.1" /translation="MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTI SPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDC QRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAV TGENLLPGIDWLLDDISSRIFTAD" BASE COUNT 125 a 165 c 165 g 100 t ORIGIN 1 atggggctcc tgaccattct gaagaagatg aagcagaaag agcgggagct gcgactgctc 61 atgcttggcc tggacaatgc tggaaagaca accatcctga agaagttcaa tggggaggac 121 atcgacacca tctccccaac gctgggcttc aacatcaaga ccctggagca ccgaggattc 181 aagctgaaca tctgggatgt gggtggccag aagtccctgc ggtcctactg gcggaactac 241 tttgagagca ccgatggcct catctgggta gtggacagcg cagaccgcca gcgcatgcag 301 gactgccagc gggagctcca gagcctgctg gtggaggagc gcctggccgg agcaaccctc 361 ctcatctttg ctaataagca ggacctgcct ggagcactgt cctctaacgc catccgcgag 421 gtcctggagc tggactccat ccgcagccac cactggtgca tccagggctg cagcgccgtc 481 accggggaga acctgctgcc gggcatcgac tggctcctgg atgacatttc cagccgcatt 541 ttcacagctg actag //