LOCUS       BT006653                 972 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol
            dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid
            dehydrogenase, type III) mRNA, complete cds.
ACCESSION   BT006653
VERSION     BT006653.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 972)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 972)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..972
                     /db_xref="H-InvDB:HIT000099573"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00670X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..972
                     /codon_start=1
                     /product="aldo-keto reductase family 1, member C2
                     (dihydrodiol dehydrogenase 2; bile acid binding protein;
                     3-alpha hydroxysteroid dehydrogenase, type III)"
                     /protein_id="AAP35299.1"
                     /translation="MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEA
                     GFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERS
                     LKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLA
                     KSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSA
                     LGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQR
                     IRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY"
BASE COUNT          270 a          220 c          244 g          238 t
ORIGIN      
        1 atggattcga aataccagtg tgtgaagctg aatgatggtc acttcatgcc tgtcctggga
       61 tttggcacct atgcgcctgc agaggttcct aaaagtaaag ctctagaggc cgtcaaattg
      121 gcaatagaag ccgggttcca ccatattgat tctgcacatg tttacaataa tgaggagcag
      181 gttggactgg ccatccgaag caagattgca gatggcagtg tgaagagaga agacatattc
      241 tacacttcaa agctttggag caattcccat cgaccagagt tggtccgacc agccttggaa
      301 aggtcactga aaaatcttca attggactat gttgacctct atcttattca ttttccagtg
      361 tctgtaaagc caggtgagga agtgatccca aaagatgaaa atggaaaaat actatttgac
      421 acagtggatc tctgtgccac atgggaggcc atggagaagt gtaaagatgc aggattggcc
      481 aagtccatcg gggtgtccaa cttcaaccac aggctgctgg agatgatcct caacaagcca
      541 gggctcaagt acaagcctgt ctgcaaccag gtggaatgtc atccttactt caaccagaga
      601 aaactgctgg atttctgcaa gtcaaaagac attgttctgg ttgcctatag tgctctggga
      661 tcccatcgag aagaaccatg ggtggacccg aactccccgg tgctcttgga ggacccagtc
      721 ctttgtgcct tggcaaaaaa gcacaagcga accccagccc tgattgccct gcgctaccag
      781 ctgcagcgtg gggttgtggt cctggccaag agctacaatg agcagcgcat cagacagaac
      841 gtgcaggtgt ttgaattcca gttgacttca gaggagatga aagccataga tggcctaaac
      901 agaaatgtgc gatatttgac ccttgatatt tttgctggcc cccctaatta tccattttct
      961 gatgaatatt ag
//