LOCUS BT006653 972 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) mRNA, complete cds. ACCESSION BT006653 VERSION BT006653.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 972) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 972) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..972 /db_xref="H-InvDB:HIT000099573" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00670X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..972 /codon_start=1 /product="aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III)" /protein_id="AAP35299.1" /translation="MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEA GFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERS LKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLA KSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSA LGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQR IRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY" BASE COUNT 270 a 220 c 244 g 238 t ORIGIN 1 atggattcga aataccagtg tgtgaagctg aatgatggtc acttcatgcc tgtcctggga 61 tttggcacct atgcgcctgc agaggttcct aaaagtaaag ctctagaggc cgtcaaattg 121 gcaatagaag ccgggttcca ccatattgat tctgcacatg tttacaataa tgaggagcag 181 gttggactgg ccatccgaag caagattgca gatggcagtg tgaagagaga agacatattc 241 tacacttcaa agctttggag caattcccat cgaccagagt tggtccgacc agccttggaa 301 aggtcactga aaaatcttca attggactat gttgacctct atcttattca ttttccagtg 361 tctgtaaagc caggtgagga agtgatccca aaagatgaaa atggaaaaat actatttgac 421 acagtggatc tctgtgccac atgggaggcc atggagaagt gtaaagatgc aggattggcc 481 aagtccatcg gggtgtccaa cttcaaccac aggctgctgg agatgatcct caacaagcca 541 gggctcaagt acaagcctgt ctgcaaccag gtggaatgtc atccttactt caaccagaga 601 aaactgctgg atttctgcaa gtcaaaagac attgttctgg ttgcctatag tgctctggga 661 tcccatcgag aagaaccatg ggtggacccg aactccccgg tgctcttgga ggacccagtc 721 ctttgtgcct tggcaaaaaa gcacaagcga accccagccc tgattgccct gcgctaccag 781 ctgcagcgtg gggttgtggt cctggccaag agctacaatg agcagcgcat cagacagaac 841 gtgcaggtgt ttgaattcca gttgacttca gaggagatga aagccataga tggcctaaac 901 agaaatgtgc gatatttgac ccttgatatt tttgctggcc cccctaatta tccattttct 961 gatgaatatt ag //