LOCUS       BT006647                 792 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 1
            mRNA, complete cds.
ACCESSION   BT006647
VERSION     BT006647.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 792)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 792)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..792
                     /db_xref="H-InvDB:HIT000099567"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00659X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..792
                     /codon_start=1
                     /product="proteasome (prosome, macropain) subunit, alpha
                     type, 1"
                     /protein_id="AAP35293.1"
                     /translation="MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVVLKSKTHA
                     VLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRP
                     LPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
                     IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKD
                     LEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH"
BASE COUNT          227 a          159 c          179 g          227 t
ORIGIN      
        1 atgtttcgaa atcagtatga caatgatgtc actgtttgga gcccccaggg caggattcat
       61 caaattgaat atgcaatgga agctgttaaa caaggttcag ccacagttgt tctgaaatca
      121 aaaactcatg cagttttggt tgcattgaaa agggcgcaat cagagcttgc agctcatcag
      181 aaaaaaattc tccatgttga caaccatatt ggtatctcaa ttgcggggct tactgctgat
      241 gctagactgt tatgtaattt tatgcgtcag gagtgtttgg attccagatt tgtattcgat
      301 agaccactgc ctgtgtctcg tcttgtatct ctaattggaa gcaagaccca gataccaaca
      361 caacgatatg gccggagacc atatggtgtt ggtctcctta ttgctggtta tgatgatatg
      421 ggccctcaca ttttccaaac ctgtccatct gctaactatt ttgactgcag agccatgtcc
      481 attggagccc gttcccaatc agctcgtact tacttggaga gacatatgtc tgaatttatg
      541 gagtgtaatt taaatgaact agttaaacat ggtctgcgtg ccttaagaga gacgcttcct
      601 gcagaacagg acctgactac aaagaatgtt tccattggaa ttgttggtaa agacttggag
      661 tttacaatct atgatgatga tgatgtgtct ccattcctgg aaggtcttga agaaagacca
      721 cagagaaagg cacagcctgc tcaacctgct gatgaacctg cagaaaaggc tgatgaacca
      781 atggaacatt ag
//