LOCUS BT006647 792 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 1 mRNA, complete cds. ACCESSION BT006647 VERSION BT006647.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 792) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 792) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..792 /db_xref="H-InvDB:HIT000099567" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00659X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..792 /codon_start=1 /product="proteasome (prosome, macropain) subunit, alpha type, 1" /protein_id="AAP35293.1" /translation="MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVVLKSKTHA VLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRP LPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKD LEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH" BASE COUNT 227 a 159 c 179 g 227 t ORIGIN 1 atgtttcgaa atcagtatga caatgatgtc actgtttgga gcccccaggg caggattcat 61 caaattgaat atgcaatgga agctgttaaa caaggttcag ccacagttgt tctgaaatca 121 aaaactcatg cagttttggt tgcattgaaa agggcgcaat cagagcttgc agctcatcag 181 aaaaaaattc tccatgttga caaccatatt ggtatctcaa ttgcggggct tactgctgat 241 gctagactgt tatgtaattt tatgcgtcag gagtgtttgg attccagatt tgtattcgat 301 agaccactgc ctgtgtctcg tcttgtatct ctaattggaa gcaagaccca gataccaaca 361 caacgatatg gccggagacc atatggtgtt ggtctcctta ttgctggtta tgatgatatg 421 ggccctcaca ttttccaaac ctgtccatct gctaactatt ttgactgcag agccatgtcc 481 attggagccc gttcccaatc agctcgtact tacttggaga gacatatgtc tgaatttatg 541 gagtgtaatt taaatgaact agttaaacat ggtctgcgtg ccttaagaga gacgcttcct 601 gcagaacagg acctgactac aaagaatgtt tccattggaa ttgttggtaa agacttggag 661 tttacaatct atgatgatga tgatgtgtct ccattcctgg aaggtcttga agaaagacca 721 cagagaaagg cacagcctgc tcaacctgct gatgaacctg cagaaaaggc tgatgaacca 781 atggaacatt ag //