LOCUS BT006639 525 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens folylpolyglutamate synthase mRNA, complete cds. ACCESSION BT006639 VERSION BT006639.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 525) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 525) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..525 /db_xref="H-InvDB:HIT000099559" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00940X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..525 /codon_start=1 /product="folylpolyglutamate synthase" /protein_id="AAP35285.1" /translation="MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSME YQDAVRMLNTLQTNAGYLEQVKRQRGDPQTQLEAMELYLARSGLQVEDLDRLNIIHVT GTKGKGSTCAFTECILRSYGLKTGFFRFGSGSASMGSPSVLSSSPSTSGASTTGWRRP RMAAVSPCPPTSAS" BASE COUNT 99 a 161 c 172 g 93 t ORIGIN 1 atgtcgcggg cgcggagcca cctgcgcgcc gctctattcc tggcagcggc gtctgcgcgc 61 ggcataacga cccaggtcgc ggcgcggcgg ggcttgagcg cgtggccggt gccgcaggag 121 ccgagcatgg agtaccagga tgccgtgcgc atgctcaata ccctgcagac caatgccggc 181 tacctggagc aggtgaagcg ccagcggggt gaccctcaga cacagttgga agccatggaa 241 ctgtacctgg cacggagtgg gctgcaggtg gaggacttgg accggctgaa catcatccac 301 gtcactggga cgaaggggaa gggctccacc tgtgccttca cggaatgtat cctccgaagc 361 tatggcctga agacgggatt ctttaggttc gggagcggat ccgcatcaat gggcagccca 421 tcagtcctga gctcttcacc aagtacttct ggcgcctcta ccaccggctg gaggagacca 481 aggatggcag ctgtgtctcc atgcccccct acttccgctt cctag //