LOCUS       BK000255                 681 bp    mRNA    linear   HUM 03-FEB-2006
DEFINITION  TPA_exp: Homo sapiens C9ORF21 (C9orf21) mRNA, complete cds.
ACCESSION   BK000255
VERSION     BK000255.1
KEYWORDS    Third Party Data; TPA; TPA:experimental.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 681)
  AUTHORS   Gilligan,P., Brenner,S. and Venkatesh,B.
  TITLE     Fugu and human sequence comparison identifies novel human genes and
            conserved non-coding sequences
  JOURNAL   Gene 294 (1-2), 35 (2002)
   PUBMED   12234665
REFERENCE   2  (bases 1 to 681)
  AUTHORS   Gilligan,P., Brenner,S. and Venkatesh,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-FEB-2002) Marine Molecular Genetics, IMCB, Medical
            Dr, Singapore 117609, Singapore
COMMENT     THIRD PARTY DATABASE: This TPA record uses data from
            DDBJ/EMBL/GenBank entry AL353578.18.
FEATURES             Location/Qualifiers
     source          1..681
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..681
                     /gene="C9orf21"
     CDS             1..681
                     /gene="C9orf21"
                     /note="PG1"
                     /codon_start=1
                     /product="C9ORF21"
                     /protein_id="DAA00065.1"
                     /translation="MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARG
                     QRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYH
                     HIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWR
                     AVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFT
                     NRPSVIHV"
BASE COUNT          160 a          183 c          183 g          155 t
ORIGIN      
        1 atggccgcgc cggccccggt cacgcggcag gttagcggcg ccgccgccct ggtcccggcc
       61 ccgagcggcc ccgacagcgg gcagcccctg gcggccgccg tggccgagct gccggtgctg
      121 gacgcccgcg ggcagcgggt accgttcggc gcgctgttcc gggagcgccg cgccgtggtg
      181 gtgttcgtgc ggcatttcct gtgttacatc tgcaaggaat acgtagagga tctggccaaa
      241 atccccagga gtttcttaca agaagcaaat gtcaccctta tagtgattgg acagtcatcc
      301 taccatcata ttgagccttt ttgcaagctg actggatatt ctcatgaaat ctatgtcgat
      361 cctgagagag aaatttataa aagattggga atgaaaagag gtgaagaaat tgcttcctca
      421 ggacagagcc cccacataaa atcaaatcta ctctcaggaa gccttcagag cctgtggcgg
      481 gcagtgactg gccctctctt tgattttcaa ggagacccag ctcagcaagg tggaaccctc
      541 attttaggtc caggtaacaa catccatttt atacaccgcg ataggaatag gttggatcac
      601 aaacctatca actctgtttt acagcttgta ggagttcagc atgtgaactt tacaaacaga
      661 ccttcagtta tccatgtgtg a
//