LOCUS BK000255 681 bp mRNA linear HUM 03-FEB-2006 DEFINITION TPA_exp: Homo sapiens C9ORF21 (C9orf21) mRNA, complete cds. ACCESSION BK000255 VERSION BK000255.1 KEYWORDS Third Party Data; TPA; TPA:experimental. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 681) AUTHORS Gilligan,P., Brenner,S. and Venkatesh,B. TITLE Fugu and human sequence comparison identifies novel human genes and conserved non-coding sequences JOURNAL Gene 294 (1-2), 35 (2002) PUBMED 12234665 REFERENCE 2 (bases 1 to 681) AUTHORS Gilligan,P., Brenner,S. and Venkatesh,B. TITLE Direct Submission JOURNAL Submitted (28-FEB-2002) Marine Molecular Genetics, IMCB, Medical Dr, Singapore 117609, Singapore COMMENT THIRD PARTY DATABASE: This TPA record uses data from DDBJ/EMBL/GenBank entry AL353578.18. FEATURES Location/Qualifiers source 1..681 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..681 /gene="C9orf21" CDS 1..681 /gene="C9orf21" /note="PG1" /codon_start=1 /product="C9ORF21" /protein_id="DAA00065.1" /translation="MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARG QRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYH HIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWR AVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFT NRPSVIHV" BASE COUNT 160 a 183 c 183 g 155 t ORIGIN 1 atggccgcgc cggccccggt cacgcggcag gttagcggcg ccgccgccct ggtcccggcc 61 ccgagcggcc ccgacagcgg gcagcccctg gcggccgccg tggccgagct gccggtgctg 121 gacgcccgcg ggcagcgggt accgttcggc gcgctgttcc gggagcgccg cgccgtggtg 181 gtgttcgtgc ggcatttcct gtgttacatc tgcaaggaat acgtagagga tctggccaaa 241 atccccagga gtttcttaca agaagcaaat gtcaccctta tagtgattgg acagtcatcc 301 taccatcata ttgagccttt ttgcaagctg actggatatt ctcatgaaat ctatgtcgat 361 cctgagagag aaatttataa aagattggga atgaaaagag gtgaagaaat tgcttcctca 421 ggacagagcc cccacataaa atcaaatcta ctctcaggaa gccttcagag cctgtggcgg 481 gcagtgactg gccctctctt tgattttcaa ggagacccag ctcagcaagg tggaaccctc 541 attttaggtc caggtaacaa catccatttt atacaccgcg ataggaatag gttggatcac 601 aaacctatca actctgtttt acagcttgta ggagttcagc atgtgaactt tacaaacaga 661 ccttcagtta tccatgtgtg a //