LOCUS BC160066 1108 bp DNA linear SYN 12-APR-2008
DEFINITION Synthetic construct Homo sapiens clone IMAGE:100064002, MGC:193181
haptoglobin-related protein (HPR) mRNA, encodes complete protein.
ACCESSION BC160066
VERSION BC160066.1
KEYWORDS MGC; ORFeome collaboration; Gateway cloning system; full-length ORF
with stop codon; de novo synthesis.
SOURCE synthetic construct
ORGANISM synthetic construct
other sequences; artificial sequences.
REFERENCE 1 (bases 1 to 1108)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1108)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (03-MAR-2008) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT This clone is a part of a collection of full-length cDNA clones
generated by Mammalian Gene Collection project. DNA synthesis was
used to prepare the protein coding sequence (ORF) and flanking
sequences, permitting directional cloning into the Gateway Entry
vector, pENTR223.1 (Details are described in
http://mgc.nci.nih.gov/Vectors/prot_pENTR223.1).
Clone structure of the ORF and flanking sequences is as follows:
5'- gtac aaa aaa gca gaa gGG CCG TCA AGG CCC ACC 5'ORF3' TAG GGC
CTC ATG Ggc cca gct ttc ttg-3'.
This clone is also a part of ORFeome collaboration clones
(http://www.orfeomecollaboration.org/).
Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Codon Devices
cDNA Library Preparation: Codon Devices, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Codon Devices, One Kendall Square, Cambridge, MA
02139 Web: http://www.codondevices.com
Ken Nesmith, Bill Adolfsen, Bettina Strack-Logue, William Blake,
Brad Chapman, Gerald Marsischky, Amy Killeen, Anna Huang, Josh
Mandel, Kathy Galle, Lee Kamentsky, Mark Pytlik, Tanuja Goulet, Ali
Munawar, Stephen Windsor, Eugene Chiu, Samir Kaul, Brian Baynes
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: OCAB Plate: 20 Row: C Column: 9.
FEATURES Location/Qualifiers
source 1..1108
/organism="synthetic construct"
/mol_type="other DNA"
/db_xref="taxon:32630"
/clone="MGC:193181 IMAGE:100064002"
/clone_lib="NIH_MGC_435"
/lab_host="DH10B"
/focus
/note="Vector: pENTR223.1 with stop codon"
source 35..1081
/organism="Homo sapiens"
/mol_type="other DNA"
/db_xref="taxon:9606"
misc_feature 1..17
/note="attL1 site"
misc_feature 18..34
/note="linker at the 5' end of the ORF that includes Sfi I
site and ACC for minimal Kozak consensus"
gene 35..1081
/gene="HPR"
/gene_synonym="A-259H10.2"
/gene_synonym="HP"
/db_xref="GeneID:3250"
/db_xref="HGNC:HGNC:5156"
/db_xref="MIM:140210"
CDS 35..1081
/gene="HPR"
/gene_synonym="A-259H10.2"
/gene_synonym="HP"
/codon_start=1
/product="haptoglobin-related protein"
/protein_id="AAI60066.1"
/db_xref="GeneID:3250"
/db_xref="HGNC:HGNC:5156"
/db_xref="MIM:140210"
/translation="MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGY
VEHLFRYQCKNYYRLRTEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQ
RILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIA
PTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVG
RVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPIL
NEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKV
TSIQHWVQKTIAEN"
misc_feature 1079..1091
/note="linker at the 3' end of the ORF that includes stop
codon TAG and Sfi I linker"
misc_feature 1092..1108
/note="attL2 site"
BASE COUNT 305 a 262 c 292 g 249 t
ORIGIN
1 gtacaaaaaa gcagaagggc cgtcaaggcc caccatgagt gacctgggag ctgtcatttc
61 cctcctgctc tggggacgac agctttttgc actgtactca ggcaatgatg tcacggatat
121 ttcagatgac cgcttcccga agccccctga gattgcaaat ggctatgtgg agcacttgtt
181 tcgctaccag tgtaagaact actacagact gcgcacagaa ggagatggag tatacacctt
241 aaatgataag aagcagtgga taaataaggc tgttggagat aaacttcctg aatgtgaagc
301 agtatgtggg aagcccaaga atccggcaaa cccagtgcag cggatcctgg gtggacacct
361 ggatgccaaa ggcagctttc cctggcaggc taagatggtt tcccaccata atctcaccac
421 aggggccacg ctgatcaatg aacaatggct gctgaccacg gctaaaaatc tcttcctgaa
481 ccattcagaa aatgcaacag cgaaagacat tgcccctact ttaacactct atgtggggaa
541 aaagcagctt gtagagattg agaaggtggt tctacaccct aactaccacc aggtagatat
601 tgggctcatc aaactcaaac agaaggtgct tgttaatgag agagtgatgc ccatctgcct
661 accttcaaag aattatgcag aagtagggcg tgtgggttac gtgtctggct ggggacaaag
721 tgacaacttt aaacttactg accatctgaa gtatgtcatg ctgcctgtgg ctgaccaata
781 cgattgcata acgcattatg aaggcagcac atgccccaaa tggaaggcac cgaagagccc
841 tgtaggggtg cagcccatac tgaacgaaca caccttctgt gtcggcatgt ctaagtacca
901 ggaagacacc tgctatggcg atgcgggcag tgcctttgcc gttcacgacc tggaggagga
961 cacctggtac gcggctggga tcctaagctt tgataagagc tgtgctgtgg ctgagtatgg
1021 tgtgtatgtg aaggtgactt ccatccagca ctgggttcag aagaccatag ctgagaacta
1081 gggcctcatg ggcccagctt tcttgtac
//