LOCUS       BC150513                 597 bp    mRNA    linear   HUM 30-AUG-2007
DEFINITION  Homo sapiens membrane-associated ring finger (C3HC4) 11, mRNA (cDNA
            clone IMAGE:40132680), complete cds.
ACCESSION   BC150513
VERSION     BC150513.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 597)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 597)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUL-2007) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRCG Plate: 25 Row: c Column: 8
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..597
                     /db_xref="H-InvDB:HIT000435836"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40132680"
                     /tissue_type="PCR rescued clones, C list"
                     /clone_lib="NIH_MGC_397"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: AACTCT sequenced from the reverse primer"
     gene            1..597
                     /gene="MARCH11"
                     /gene_synonym="MARCH-XI"
                     /db_xref="GeneID:441061"
                     /db_xref="HGNC:HGNC:33609"
     CDS             75..551
                     /gene="MARCH11"
                     /gene_synonym="MARCH-XI"
                     /codon_start=1
                     /product="MARCH11 protein"
                     /protein_id="AAI50514.1"
                     /db_xref="GeneID:441061"
                     /db_xref="HGNC:HGNC:33609"
                     /translation="MIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYG
                     FMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWL
                     PLTALRNRNLVHPTQLTSPRFQCGYVLLHLFNRMRPHEDLSEDNSSGEVVMRVTSV"
BASE COUNT          150 a          122 c          153 g          172 t
ORIGIN      
        1 cagccctttc ttacatgcct ctgtttttct tttagtggca gagcatttct ataacactgg
       61 ttgagaaagt tcagatgatt gctgtaatcc taggatccct gttcttaata gccagtgtga
      121 cttggctcct ctggtcagcc ttcagcccct atgcagtgtg gcagaggaag gacatccttt
      181 ttcagatctg ctatggaatg tatggtttta tggatctagt gtgcataggt ctcattgttc
      241 atgaaggagc tgcagtttac agagtgttta agcgctggcg agctgtgaat ttgcactggg
      301 atgtgttaaa ttatgacaaa gccacagaca tcgaagaaag cagccgggga gagtcttcca
      361 caagtaggac tttgtggttg ccattgacag ctctgcggaa cagaaacttg gtccacccaa
      421 ctcagttaac ctcaccaagg tttcagtgtg gctatgtgtt attgcacctg ttcaatcgga
      481 tgaggcccca tgaagactta tcagaagata acagctcggg ggaggttgtg atgagagtga
      541 cttcagtgtg acaaaagcat aagatgatgc agtgtggacc accctgcaca ttttgaa
//