LOCUS BC150513 597 bp mRNA linear HUM 30-AUG-2007 DEFINITION Homo sapiens membrane-associated ring finger (C3HC4) 11, mRNA (cDNA clone IMAGE:40132680), complete cds. ACCESSION BC150513 VERSION BC150513.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 597) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 597) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (13-JUL-2007) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRCG Plate: 25 Row: c Column: 8 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..597 /db_xref="H-InvDB:HIT000435836" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40132680" /tissue_type="PCR rescued clones, C list" /clone_lib="NIH_MGC_397" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: AACTCT sequenced from the reverse primer" gene 1..597 /gene="MARCH11" /gene_synonym="MARCH-XI" /db_xref="GeneID:441061" /db_xref="HGNC:HGNC:33609" CDS 75..551 /gene="MARCH11" /gene_synonym="MARCH-XI" /codon_start=1 /product="MARCH11 protein" /protein_id="AAI50514.1" /db_xref="GeneID:441061" /db_xref="HGNC:HGNC:33609" /translation="MIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYG FMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWL PLTALRNRNLVHPTQLTSPRFQCGYVLLHLFNRMRPHEDLSEDNSSGEVVMRVTSV" BASE COUNT 150 a 122 c 153 g 172 t ORIGIN 1 cagccctttc ttacatgcct ctgtttttct tttagtggca gagcatttct ataacactgg 61 ttgagaaagt tcagatgatt gctgtaatcc taggatccct gttcttaata gccagtgtga 121 cttggctcct ctggtcagcc ttcagcccct atgcagtgtg gcagaggaag gacatccttt 181 ttcagatctg ctatggaatg tatggtttta tggatctagt gtgcataggt ctcattgttc 241 atgaaggagc tgcagtttac agagtgttta agcgctggcg agctgtgaat ttgcactggg 301 atgtgttaaa ttatgacaaa gccacagaca tcgaagaaag cagccgggga gagtcttcca 361 caagtaggac tttgtggttg ccattgacag ctctgcggaa cagaaacttg gtccacccaa 421 ctcagttaac ctcaccaagg tttcagtgtg gctatgtgtt attgcacctg ttcaatcgga 481 tgaggcccca tgaagactta tcagaagata acagctcggg ggaggttgtg atgagagtga 541 cttcagtgtg acaaaagcat aagatgatgc agtgtggacc accctgcaca ttttgaa //