LOCUS       BC148465                 331 bp    DNA     linear   SYN 23-JUL-2016
DEFINITION  Synthetic construct Homo sapiens clone IMAGE:100015380, MGC:183012
            neuropeptide S (NPS) mRNA, encodes complete protein.
ACCESSION   BC148465
VERSION     BC148465.1
KEYWORDS    MGC; ORFeome collaboration; Gateway cloning system; full-length ORF
            without stop codon; de novo synthesis.
SOURCE      synthetic construct
  ORGANISM  synthetic construct
            other sequences; artificial sequences.
REFERENCE   1  (bases 1 to 331)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 331)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUL-2007) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     This clone is a part of a collection of full-length cDNA clones
            generated by Mammalian Gene Collection project. DNA synthesis was
            used to prepare the protein coding sequence (ORF) and flanking
            sequences, permitting directional cloning into the Gateway Entry
            vector, pENTR223.1 (Details are described in
            http://mgc.nci.nih.gov/Vectors/prot_pENTR223.1).
            
            Clone structure of the ORF and flanking sequences is as follows:
            5'- gtac aaa aaa gca gaa gGG CCG TCA AGG CCC ACC 5'ORF3' TCA GGC
            CTC ATG Ggc cca gct ttc ttg-3'.
            
            This clone is also a part of ORFeome collaboration clones
            (http://www.orfeomecollaboration.org/).
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Geneart
            cDNA Library Preparation: GeneArt
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Geneart - the gene of your choice:
            www.geneart.com
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRCV Plate: 4 Row: d Column: 3.
FEATURES             Location/Qualifiers
     source          1..331
                     /organism="synthetic construct"
                     /mol_type="other DNA"
                     /db_xref="taxon:32630"
                     /clone="IMAGE:100015380"
                     /clone_lib="NIH_MGC_425"
                     /lab_host="DH10B"
                     /focus
                     /note="Vector: pENTR223.1 without stop codon"
     source          35..301
                     /organism="Homo sapiens"
                     /mol_type="other DNA"
                     /db_xref="taxon:9606"
     misc_feature    1..17
                     /note="attL1 site"
     misc_feature    18..34
                     /note="linker at the 5' end of the ORF that includes Sfi I
                     site and ACC for minimal Kozak consensus"
     gene            35..>301
                     /gene="NPS"
                     /db_xref="GeneID:594857"
                     /db_xref="MIM:609513"
     CDS             35..>301
                     /gene="NPS"
                     /codon_start=1
                     /product="neuropeptide S"
                     /protein_id="AAI48466.1"
                     /db_xref="GeneID:594857"
                     /db_xref="MIM:609513"
                     /translation="MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNS
                     CPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS"
     misc_feature    302..314
                     /note="linker at the 3' end of the ORF"
     misc_feature    315..331
                     /note="attL2 site"
BASE COUNT           96 a           74 c           70 g           91 t
ORIGIN      
        1 gtacaaaaaa gcagaagggc cgtcaaggcc caccatgatt agctcagtaa aactcaatct
       61 catcctagtt ctgtcgctgt ccacaatgca tgtgttttgg tgttatccag ttccatcttc
      121 taaggtgtct ggaaaatctg attactttct cattctgctg aacagctgcc caaccagatt
      181 ggacaggagc aaagaactag cttttctaaa gccaattttg gagaagatgt ttgtgaaaag
      241 gtcctttcgc aatggagttg gcacagggat gaaaaaaact tcctttcaaa gagcaaaatc
      301 atcaggcctc atgggcccag ctttcttgta c
//