LOCUS BC148465 331 bp DNA linear SYN 23-JUL-2016 DEFINITION Synthetic construct Homo sapiens clone IMAGE:100015380, MGC:183012 neuropeptide S (NPS) mRNA, encodes complete protein. ACCESSION BC148465 VERSION BC148465.1 KEYWORDS MGC; ORFeome collaboration; Gateway cloning system; full-length ORF without stop codon; de novo synthesis. SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 (bases 1 to 331) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 331) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (05-JUL-2007) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT This clone is a part of a collection of full-length cDNA clones generated by Mammalian Gene Collection project. DNA synthesis was used to prepare the protein coding sequence (ORF) and flanking sequences, permitting directional cloning into the Gateway Entry vector, pENTR223.1 (Details are described in http://mgc.nci.nih.gov/Vectors/prot_pENTR223.1). Clone structure of the ORF and flanking sequences is as follows: 5'- gtac aaa aaa gca gaa gGG CCG TCA AGG CCC ACC 5'ORF3' TCA GGC CTC ATG Ggc cca gct ttc ttg-3'. This clone is also a part of ORFeome collaboration clones (http://www.orfeomecollaboration.org/). Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Geneart cDNA Library Preparation: GeneArt cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Geneart - the gene of your choice: www.geneart.com Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRCV Plate: 4 Row: d Column: 3. FEATURES Location/Qualifiers source 1..331 /organism="synthetic construct" /mol_type="other DNA" /db_xref="taxon:32630" /clone="IMAGE:100015380" /clone_lib="NIH_MGC_425" /lab_host="DH10B" /focus /note="Vector: pENTR223.1 without stop codon" source 35..301 /organism="Homo sapiens" /mol_type="other DNA" /db_xref="taxon:9606" misc_feature 1..17 /note="attL1 site" misc_feature 18..34 /note="linker at the 5' end of the ORF that includes Sfi I site and ACC for minimal Kozak consensus" gene 35..>301 /gene="NPS" /db_xref="GeneID:594857" /db_xref="MIM:609513" CDS 35..>301 /gene="NPS" /codon_start=1 /product="neuropeptide S" /protein_id="AAI48466.1" /db_xref="GeneID:594857" /db_xref="MIM:609513" /translation="MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNS CPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS" misc_feature 302..314 /note="linker at the 3' end of the ORF" misc_feature 315..331 /note="attL2 site" BASE COUNT 96 a 74 c 70 g 91 t ORIGIN 1 gtacaaaaaa gcagaagggc cgtcaaggcc caccatgatt agctcagtaa aactcaatct 61 catcctagtt ctgtcgctgt ccacaatgca tgtgttttgg tgttatccag ttccatcttc 121 taaggtgtct ggaaaatctg attactttct cattctgctg aacagctgcc caaccagatt 181 ggacaggagc aaagaactag cttttctaaa gccaattttg gagaagatgt ttgtgaaaag 241 gtcctttcgc aatggagttg gcacagggat gaaaaaaact tcctttcaaa gagcaaaatc 301 atcaggcctc atgggcccag ctttcttgta c //