LOCUS BC134414 1044 bp mRNA linear HUM 06-MAR-2007
DEFINITION Homo sapiens transient receptor potential cation channel, subfamily
M, member 3, mRNA (cDNA clone IMAGE:40109229), complete cds.
ACCESSION BC134414
VERSION BC134414.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1044)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1044)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (04-MAR-2007) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Baylor Human Genome Sequencing Center
cDNA Library Preparation: Baylor Human Genome Sequencing Center
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRCG Plate: 15 Row: a Column: 2
This clone has the following problem: The cds is short compared to
the longest cds in the locus.
FEATURES Location/Qualifiers
source 1..1044
/db_xref="H-InvDB:HIT000391146"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:40109229"
/tissue_type="PCR rescued clones"
/clone_lib="NIH_MGC_282"
/note="Vector: pCR-Blunt II-TOPO; Clone identification
sequence tag: NA"
gene 1..1044
/gene="TRPM3"
/gene_synonym="GON-2"
/gene_synonym="LTRPC3"
/gene_synonym="MLSN2"
/db_xref="GeneID:80036"
/db_xref="HGNC:HGNC:17992"
/db_xref="MIM:608961"
CDS 205..897
/gene="TRPM3"
/gene_synonym="GON-2"
/gene_synonym="LTRPC3"
/gene_synonym="MLSN2"
/codon_start=1
/product="transient receptor potential cation channel,
subfamily M, member 3"
/protein_id="AAI34415.1"
/db_xref="GeneID:80036"
/db_xref="HGNC:HGNC:17992"
/db_xref="MIM:608961"
/translation="MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQP
KLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWG
IVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQL
EKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDI
LAFGHKYSEEGG"
BASE COUNT 291 a 243 c 263 g 247 t
ORIGIN
1 aggtgttgct gtgggcgtct gataggctag catgttggcc tcacccccag tatctccgtg
61 cttcagaatg agaaaaatga aagtcgcctc tcccgaaatg acatccagtc tgaaaagtgg
121 tccatcagca aacacactca actcagccct acggatgctt ttgggaccat tgagttccaa
181 ggaggtggcc attccaacaa agccatgtat gtgcgagtat cttttgatac aaaacctgat
241 ctcctcttac acctgatgac caaggaatgg cagttggagc ttcccaagct tctcatctct
301 gtccatgggg gcctgcagaa ctttgaactc cagccaaaac tcaagcaagt ctttgggaaa
361 gggctcatca aagcagctat gacaactgga gcgtggatat tcactggagg ggttaacaca
421 ggtgttattc gtcatgttgg cgatgccttg aaggatcatg cctctaagtc tcgaggaaag
481 atatgcacca taggtattgc cccctgggga attgtggaaa accaggagga cctcattgga
541 agagatgttg tccggccata ccagaccatg tccaatccca tgagcaagct cactgttctc
601 aacagcatgc attcccactt cattctggct gacaacggga ccactggaaa atatggagca
661 gaggtgaaac ttcgaagaca actggaaaag catatttcac tccagaagat aaacacaaga
721 atcggtcaag gtgttcctgt ggtggcactc atagtggaag gaggacccaa tgtgatctcg
781 attgttttgg agtaccttcg agacacccct cccgtgccag tggttgtctg tgatgggagt
841 ggacgggcat cggacatcct ggcctttggg cataaatact cagaagaagg cgggtaggta
901 actttccagg ccccatggaa gaaccctaaa gcctgtttgg aaacgagggt atgagtggat
961 tatgttttca gtagctcaac caagacctca aatcaaaaca agctatgaac aaattgtcta
1021 aaaaatgtct gtcatgggag ggct
//