LOCUS BC133691 716 bp mRNA linear HUM 06-MAR-2007 DEFINITION Homo sapiens glutathione peroxidase 6 (olfactory), mRNA (cDNA clone IMAGE:40120192), complete cds. ACCESSION BC133691 VERSION BC133691.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 716) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 716) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (02-MAR-2007) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRCG Plate: 15 Row: d Column: 12 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..716 /db_xref="H-InvDB:HIT000391121" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40120192" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: TGAACATT sequenced from the reverse primer" gene 1..716 /gene="GPX6" /db_xref="GeneID:257202" /db_xref="HGNC:HGNC:4558" /db_xref="MIM:607913" CDS 45..263 /gene="GPX6" /codon_start=1 /product="GPX6 protein" /protein_id="AAI33692.1" /db_xref="GeneID:257202" /db_xref="HGNC:HGNC:4558" /db_xref="MIM:607913" /translation="MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYG ALTLNGEEYIQFKQFAGKHVLFVNVAAY" BASE COUNT 179 a 198 c 162 g 177 t ORIGIN 1 ggctgaaatc ctggggacct cagagtcgtc taaaactcct agccatgttc cagcagttcc 61 aggcctcctg tcttgtcctg tttttcctgg ttggctttgc tcagcagacc ctaaagcctc 121 aaaataggaa ggtggattgc aacaaagggg taacaggcac catctatgag tatggagccc 181 tcaccctcaa cggcgaggag tacatccaat tcaagcagtt tgcaggcaag cacgtcctgt 241 ttgtcaatgt ggccgcctat tgaggcttgg cagctcagta tcctgaactg aatgcactac 301 aggaggagct gaagaatttt ggtgtcattg tgttggcctt tccctgcaac cagtttggaa 361 aacaagaacc aggaacaaac tcagaaatac ttcttggtct caaaactcct gccctccgac 421 ctctgatctt ttgggctcat caagccaact cttctgggag cccatgaagg tccatgatat 481 ccgctggaac tttgagaaat ttctggtggg gcccgatgga gtccctgtca tgcattggtt 541 ccaccaggct ccagtcagca cagtcaagtc agacatcctg gagtacctaa agcagttcaa 601 tacccactag gaagggctag cgactgacag aaataactac cctgtctccc acctgcagga 661 atgtctaaca aagcatccat cttcctcctt ctttgctcca cactcgtgcc taccca //