LOCUS       BC133691                 716 bp    mRNA    linear   HUM 06-MAR-2007
DEFINITION  Homo sapiens glutathione peroxidase 6 (olfactory), mRNA (cDNA clone
            IMAGE:40120192), complete cds.
ACCESSION   BC133691
VERSION     BC133691.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 716)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 716)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2007) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRCG Plate: 15 Row: d Column: 12
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..716
                     /db_xref="H-InvDB:HIT000391121"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40120192"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: TGAACATT sequenced from the reverse primer"
     gene            1..716
                     /gene="GPX6"
                     /db_xref="GeneID:257202"
                     /db_xref="HGNC:HGNC:4558"
                     /db_xref="MIM:607913"
     CDS             45..263
                     /gene="GPX6"
                     /codon_start=1
                     /product="GPX6 protein"
                     /protein_id="AAI33692.1"
                     /db_xref="GeneID:257202"
                     /db_xref="HGNC:HGNC:4558"
                     /db_xref="MIM:607913"
                     /translation="MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYG
                     ALTLNGEEYIQFKQFAGKHVLFVNVAAY"
BASE COUNT          179 a          198 c          162 g          177 t
ORIGIN      
        1 ggctgaaatc ctggggacct cagagtcgtc taaaactcct agccatgttc cagcagttcc
       61 aggcctcctg tcttgtcctg tttttcctgg ttggctttgc tcagcagacc ctaaagcctc
      121 aaaataggaa ggtggattgc aacaaagggg taacaggcac catctatgag tatggagccc
      181 tcaccctcaa cggcgaggag tacatccaat tcaagcagtt tgcaggcaag cacgtcctgt
      241 ttgtcaatgt ggccgcctat tgaggcttgg cagctcagta tcctgaactg aatgcactac
      301 aggaggagct gaagaatttt ggtgtcattg tgttggcctt tccctgcaac cagtttggaa
      361 aacaagaacc aggaacaaac tcagaaatac ttcttggtct caaaactcct gccctccgac
      421 ctctgatctt ttgggctcat caagccaact cttctgggag cccatgaagg tccatgatat
      481 ccgctggaac tttgagaaat ttctggtggg gcccgatgga gtccctgtca tgcattggtt
      541 ccaccaggct ccagtcagca cagtcaagtc agacatcctg gagtacctaa agcagttcaa
      601 tacccactag gaagggctag cgactgacag aaataactac cctgtctccc acctgcagga
      661 atgtctaaca aagcatccat cttcctcctt ctttgctcca cactcgtgcc taccca
//