LOCUS BC128438 241 bp mRNA linear HUM 18-MAR-2009 DEFINITION Homo sapiens defensin, beta 105B, mRNA (cDNA clone MGC:156233 IMAGE:40119534), complete cds. ACCESSION BC128438 VERSION BC128438.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 241) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 241) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (05-DEC-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 30 Row: l Column: 6. FEATURES Location/Qualifiers source 1..241 /db_xref="H-InvDB:HIT000389849_04" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:156233 IMAGE:40119534" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: CGCCCACA sequenced from the reverse primer" gene 1..241 /gene="DEFB105B" /db_xref="GeneID:504180" /db_xref="HGNC:HGNC:29930" CDS 5..241 /gene="DEFB105B" /codon_start=1 /product="defensin, beta 105B" /protein_id="AAI28439.1" /db_xref="GeneID:504180" /db_xref="HGNC:HGNC:29930" /translation="MALIRKTFYFLFAMFFILVQLPSGCQAGLDFSQPFPSGEFAVCE SCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI" BASE COUNT 58 a 46 c 65 g 72 t ORIGIN 1 aacaatggcc ctgatcagga agacatttta ttttctattt gctatgttct tcattttggt 61 tcaactgcca tcagggtgcc aggcaggact tgatttttcc caaccatttc catcaggtga 121 gtttgctgtc tgtgagtcgt gcaagcttgg tcggggaaaa tgcaggaagg agtgcttgga 181 gaatgagaag cccgatggaa attgtaggct gaactttctc tgctgcagac agaggatctg 241 a //