LOCUS BC128399 629 bp mRNA linear HUM 05-DEC-2006 DEFINITION Homo sapiens A kinase (PRKA) anchor protein 7, mRNA (cDNA clone IMAGE:40108976), complete cds. ACCESSION BC128399 VERSION BC128399.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 629) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 629) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (05-DEC-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 30 Row: a Column: 10 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..629 /db_xref="H-InvDB:HIT000389810" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40108976" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: NA" gene 1..629 /gene="AKAP7" /gene_synonym="AKAP18" /db_xref="GeneID:9465" /db_xref="HGNC:HGNC:377" /db_xref="MIM:604693" CDS 188..433 /gene="AKAP7" /gene_synonym="AKAP18" /codon_start=1 /product="A kinase (PRKA) anchor protein 7" /protein_id="AAI28400.1" /db_xref="GeneID:9465" /db_xref="HGNC:HGNC:377" /db_xref="MIM:604693" /translation="MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKA VQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK" BASE COUNT 168 a 146 c 178 g 137 t ORIGIN 1 ctcacggcag caagttccct tctcctttct ctcccccggc ggcgtgtgca ttggctcttc 61 aagctgcctg tgctgctccg tggagtgaaa aaggcagggt gtgctcgcag actgtgctat 121 aaactgcaat ttctatttgg ggtcctcacg gagaagaaca ccaggaaaga cagacaggac 181 cagtgccatg ggccagcttt gctgctttcc tttctcaaga gatgaaggaa aaatcagtga 241 aaagaacgga ggggagcccg atgacgctga actagtaagg ctcagtaaga ggctggtgga 301 gaacgcggtg ctcaaggctg tccagcagta tctggaggaa acacagaata aaaacaagcc 361 gggggagggg agctctgtga aaaccgaagc agctgatcag aatggcaatg acaatgagaa 421 caacaggaaa tgagcccgga acgcaggccc ccatgtctct gtgcaaagcc tccctgcttc 481 cctctgctga gtctagggac tgacttgcag cgtgctgttt aagttaagtt tctctggtgc 541 aatctgtgaa gattgcctaa tacttttcat gatcgatgtg ttcgcattgc tgaaacacaa 601 cagaagaaaa atggagtgct gggactggc //