LOCUS       BC128398                 629 bp    mRNA    linear   HUM 05-DEC-2006
DEFINITION  Homo sapiens A kinase (PRKA) anchor protein 7, mRNA (cDNA clone
            IMAGE:40108973), complete cds.
ACCESSION   BC128398
VERSION     BC128398.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 629)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 629)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 30 Row: a Column: 9
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..629
                     /db_xref="H-InvDB:HIT000389809"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40108973"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: NA"
     gene            1..629
                     /gene="AKAP7"
                     /gene_synonym="AKAP18"
                     /db_xref="GeneID:9465"
                     /db_xref="HGNC:HGNC:377"
                     /db_xref="MIM:604693"
     CDS             188..433
                     /gene="AKAP7"
                     /gene_synonym="AKAP18"
                     /codon_start=1
                     /product="A kinase (PRKA) anchor protein 7"
                     /protein_id="AAI28399.1"
                     /db_xref="GeneID:9465"
                     /db_xref="HGNC:HGNC:377"
                     /db_xref="MIM:604693"
                     /translation="MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKA
                     VQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK"
BASE COUNT          168 a          146 c          178 g          137 t
ORIGIN      
        1 ctcacggcag caagttccct tctcctttct ctcccccggc ggcgtgtgca ttggctcttc
       61 aagctgcctg tgctgctccg tggagtgaaa aaggcagggt gtgctcgcag actgtgctat
      121 aaactgcaat ttctatttgg ggtcctcacg gagaagaaca ccaggaaaga cagacaggac
      181 cagtgccatg ggccagcttt gctgctttcc tttctcaaga gatgaaggaa aaatcagtga
      241 aaagaacgga ggggagcccg atgacgctga actagtaagg ctcagtaaga ggctggtgga
      301 gaacgcggtg ctcaaggctg tccagcagta tctggaggaa acacagaata aaaacaagcc
      361 gggggagggg agctctgtga aaaccgaagc agctgatcag aatggcaatg acaatgagaa
      421 caacaggaaa tgagcccgga acgcaggccc ccatgtctct gtgcaaagcc tccctgcttc
      481 cctctgctga gtctagggac tgacttgcag cgtgctgttt aagttaagtt tctctggtgc
      541 aatctgtgaa gattgcctaa tacttttcat gatcgatgtg ttcgcattgc tgaaacacaa
      601 cagaagaaaa atggagtgct gggactggc
//