LOCUS       BC128252                 362 bp    mRNA    linear   HUM 05-DEC-2006
DEFINITION  Homo sapiens secretoglobin, family 2A, member 2, mRNA (cDNA clone
            MGC:149421 IMAGE:40115103), complete cds.
ACCESSION   BC128252
VERSION     BC128252.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 362)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 362)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 30 Row: i Column: 7.
FEATURES             Location/Qualifiers
     source          1..362
                     /db_xref="H-InvDB:HIT000389778"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:149421 IMAGE:40115103"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: TTTCCAA sequenced from the reverse primer"
     gene            1..362
                     /gene="SCGB2A2"
                     /gene_synonym="UGB2"
                     /db_xref="GeneID:4250"
                     /db_xref="HGNC:HGNC:7050"
                     /db_xref="MIM:605562"
     CDS             55..336
                     /gene="SCGB2A2"
                     /gene_synonym="UGB2"
                     /codon_start=1
                     /product="secretoglobin, family 2A, member 2"
                     /protein_id="AAI28253.1"
                     /db_xref="GeneID:4250"
                     /db_xref="HGNC:HGNC:7050"
                     /db_xref="MIM:605562"
                     /translation="MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKE
                     LLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF"
BASE COUNT          101 a           89 c           74 g           98 t
ORIGIN      
        1 ggcttccttg atccttgcca cccgcgactg aacaccgaca gcagcagcct caccatgaag
       61 ttgctgatgg tcctcatgct ggcggccctc tcccagcact gctacgcagg ctctggctgc
      121 cccttattgg agaatgtgat ttccaagaca atcaatccac aagtgtctaa gactgaatac
      181 aaagaacttc ttcaagagtt catagacgac aatgccacta caaatgccat agatgaattg
      241 aaggaatgtt ttcttaacca aacggatgaa actctgagca atgttgaggt gtttatgcaa
      301 ttaatatatg acagcagtct ttgtgattta ttttaacttt ctgcaagacc tttggctcac
      361 ag
//