LOCUS BC128252 362 bp mRNA linear HUM 05-DEC-2006 DEFINITION Homo sapiens secretoglobin, family 2A, member 2, mRNA (cDNA clone MGC:149421 IMAGE:40115103), complete cds. ACCESSION BC128252 VERSION BC128252.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 362) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 362) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (05-DEC-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 30 Row: i Column: 7. FEATURES Location/Qualifiers source 1..362 /db_xref="H-InvDB:HIT000389778" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:149421 IMAGE:40115103" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: TTTCCAA sequenced from the reverse primer" gene 1..362 /gene="SCGB2A2" /gene_synonym="UGB2" /db_xref="GeneID:4250" /db_xref="HGNC:HGNC:7050" /db_xref="MIM:605562" CDS 55..336 /gene="SCGB2A2" /gene_synonym="UGB2" /codon_start=1 /product="secretoglobin, family 2A, member 2" /protein_id="AAI28253.1" /db_xref="GeneID:4250" /db_xref="HGNC:HGNC:7050" /db_xref="MIM:605562" /translation="MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKE LLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF" BASE COUNT 101 a 89 c 74 g 98 t ORIGIN 1 ggcttccttg atccttgcca cccgcgactg aacaccgaca gcagcagcct caccatgaag 61 ttgctgatgg tcctcatgct ggcggccctc tcccagcact gctacgcagg ctctggctgc 121 cccttattgg agaatgtgat ttccaagaca atcaatccac aagtgtctaa gactgaatac 181 aaagaacttc ttcaagagtt catagacgac aatgccacta caaatgccat agatgaattg 241 aaggaatgtt ttcttaacca aacggatgaa actctgagca atgttgaggt gtttatgcaa 301 ttaatatatg acagcagtct ttgtgattta ttttaacttt ctgcaagacc tttggctcac 361 ag //