LOCUS BC128094 1060 bp mRNA linear HUM 18-MAR-2009
DEFINITION Homo sapiens plexin B1, mRNA (cDNA clone IMAGE:40109090), complete
cds.
ACCESSION BC128094
VERSION BC128094.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1060)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1060)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (05-DEC-2006) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Baylor Human Genome Sequencing Center
cDNA Library Preparation: Baylor Human Genome Sequencing Center
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAM Plate: 30 Row: a Column: 12
This clone has the following problem: The cds is short compared to
the longest cds in the locus.
FEATURES Location/Qualifiers
source 1..1060
/db_xref="H-InvDB:HIT000389623"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:40109090"
/tissue_type="PCR rescued clones"
/clone_lib="NIH_MGC_283"
/note="Vector: pCR-Blunt II-TOPO with reversed insert;
Clone identification sequence tag: NA"
gene 1..1060
/gene="PLXNB1"
/gene_synonym="PLEXIN-B1"
/gene_synonym="SEP"
/db_xref="GeneID:5364"
/db_xref="HGNC:HGNC:9103"
/db_xref="MIM:601053"
CDS 154..408
/gene="PLXNB1"
/gene_synonym="PLEXIN-B1"
/gene_synonym="SEP"
/codon_start=1
/product="PLXNB1 protein"
/protein_id="AAI28095.1"
/db_xref="GeneID:5364"
/db_xref="HGNC:HGNC:9103"
/db_xref="MIM:601053"
/translation="MPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRH
HLYCEPPVEQPLPRHHALREAPDSLPEFTVSGQVPGRAGH"
BASE COUNT 201 a 270 c 346 g 243 t
ORIGIN
1 agcacatact aatcaggcct gcctgaggac ccctgggtcc gggtggaatt tatccttgac
61 aacctggtct ttgactttgc aacactgaac cccacacctt tctcctatga ggccgacccc
121 accctgcagc cactcaaccc tgaggacccc accatgccat tccggcacaa gcctgggagt
181 gtgttctccg tggaggggga gaacctggac cttgcaatgt ccaaggagga ggtggtggct
241 atgatagggg atggcccctg tgtggtgaag acgctgacgc ggcaccacct gtactgcgag
301 ccccccgtgg agcagcccct gccacggcac catgccctcc gagaggcacc tgactctttg
361 cctgagttca cggtcagtgg gcaggtccct ggccgggctg ggcattgacc tgggccaaac
421 ccttgctcac aggtggctcc tgacacaggt gcagatgggg aacttgcgct tctccctggg
481 tcacgtgcag tatgacggcg agagccctgg ggcttttcct gtggcagccc aggtgggctt
541 gggggtgggc acctctcttc tggctctggg tgtcatcatc attgtcctca tgtacaggtg
601 ggtgcagcca gatgtggctg ggctggggca ggtcgtggga tctggctgga ctgggaaggg
661 acagaccggg ccaggagtca ggaaacattc tctgtaaatg gccagagagt aaatattttc
721 gctttgcagg ccaagtggtc tctgttcaac aactcagctt tgccactgtg gcacaaaggc
781 agccagggac gacatggaaa cacatgaaag tggctgtgtt ctaacaaatc tttataaaaa
841 taggttgtgg gatggatttg gcctggttgt ggttggctga tctctaggct aaactgtgct
901 gggctagacg gggcatgggt gtgtgtgact tgcttgggac gggacaggct gaatcgtact
961 gggctaggct tgagcttggc tggcatggct gcattggact gtgctggatg aggccggggt
1021 gtgcctgggg attgtcaggc aggcctgatt agtatgtgct
//