LOCUS       BC127726                 632 bp    mRNA    linear   HUM 18-MAR-2009
DEFINITION  Homo sapiens ankyrin repeat domain 20 family, member A5, mRNA (cDNA
            clone MGC:157829 IMAGE:40127384), complete cds.
ACCESSION   BC127726
VERSION     BC127726.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 632)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 632)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (18-NOV-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 32 Row: c Column: 16.
FEATURES             Location/Qualifiers
     source          1..632
                     /db_xref="H-InvDB:HIT000389353"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:157829 IMAGE:40127384"
                     /tissue_type="PCR rescued clones, C list"
                     /clone_lib="NIH_MGC_398"
                     /note="Vector: pCR-Blunt II-TOPO with reversed insert;
                     Clone identification sequence tag: TGACTAT sequenced from
                     the reverse primer"
     gene            1..632
                     /gene="ANKRD20A5"
                     /db_xref="GeneID:440482"
                     /db_xref="HGNC:HGNC:33833"
     CDS             78..575
                     /gene="ANKRD20A5"
                     /codon_start=1
                     /product="ANKRD20A5 protein"
                     /protein_id="AAI27727.1"
                     /db_xref="GeneID:440482"
                     /db_xref="HGNC:HGNC:33833"
                     /translation="MKLFGFRSRRGQTVLGSIDHLYTGSGYRIRYSELQKIHKAAVKG
                     DAAEMERCLARRSGDLDALDKQHRTALHLACASGHVKVVTLLVNRKCQIDIYDKENRT
                     PLIQAVHCQEEACAVILLEHGANPNLKDIYGNTALHYAVYSESTSLAEKLLFHGENIE
                     ALDKV"
BASE COUNT          170 a          148 c          172 g          142 t
ORIGIN      
        1 gaggcgggtg gtgaaaaggt aacagggagc tgccccctct caagagccgg tagttgggag
       61 tctgagaagt caccaccatg aagttgttcg gcttcaggag ccgcaggggc cagacggtcc
      121 tgggctccat agaccacctc tacacgggtt ccgggtaccg aatccggtac tcggaactgc
      181 agaagatcca caaggcagct gtcaagggcg acgctgcgga gatggagcgc tgtctggcgc
      241 gcaggagcgg agaccttgac gccctggaca agcagcacag aactgctcta catttggcct
      301 gtgccagtgg ccatgtgaaa gtggtcactc tcctggttaa cagaaaatgt cagattgata
      361 tctatgacaa agaaaataga acgcctttga tacaggctgt ccattgccag gaagaggctt
      421 gtgccgttat tctgctggaa catggtgcca atccaaacct taaggatatc tacggcaaca
      481 ctgctctcca ttatgctgtg tatagtgaga gcacctcact ggcagaaaaa ctgcttttcc
      541 atggtgaaaa tattgaagca ctggacaagg tatagatcaa tcaactttct ttccaaaata
      601 tttgttttaa cattgacata ggtaagggtc aa
//