LOCUS BC127726 632 bp mRNA linear HUM 18-MAR-2009 DEFINITION Homo sapiens ankyrin repeat domain 20 family, member A5, mRNA (cDNA clone MGC:157829 IMAGE:40127384), complete cds. ACCESSION BC127726 VERSION BC127726.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 632) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 632) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (18-NOV-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 32 Row: c Column: 16. FEATURES Location/Qualifiers source 1..632 /db_xref="H-InvDB:HIT000389353" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:157829 IMAGE:40127384" /tissue_type="PCR rescued clones, C list" /clone_lib="NIH_MGC_398" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: TGACTAT sequenced from the reverse primer" gene 1..632 /gene="ANKRD20A5" /db_xref="GeneID:440482" /db_xref="HGNC:HGNC:33833" CDS 78..575 /gene="ANKRD20A5" /codon_start=1 /product="ANKRD20A5 protein" /protein_id="AAI27727.1" /db_xref="GeneID:440482" /db_xref="HGNC:HGNC:33833" /translation="MKLFGFRSRRGQTVLGSIDHLYTGSGYRIRYSELQKIHKAAVKG DAAEMERCLARRSGDLDALDKQHRTALHLACASGHVKVVTLLVNRKCQIDIYDKENRT PLIQAVHCQEEACAVILLEHGANPNLKDIYGNTALHYAVYSESTSLAEKLLFHGENIE ALDKV" BASE COUNT 170 a 148 c 172 g 142 t ORIGIN 1 gaggcgggtg gtgaaaaggt aacagggagc tgccccctct caagagccgg tagttgggag 61 tctgagaagt caccaccatg aagttgttcg gcttcaggag ccgcaggggc cagacggtcc 121 tgggctccat agaccacctc tacacgggtt ccgggtaccg aatccggtac tcggaactgc 181 agaagatcca caaggcagct gtcaagggcg acgctgcgga gatggagcgc tgtctggcgc 241 gcaggagcgg agaccttgac gccctggaca agcagcacag aactgctcta catttggcct 301 gtgccagtgg ccatgtgaaa gtggtcactc tcctggttaa cagaaaatgt cagattgata 361 tctatgacaa agaaaataga acgcctttga tacaggctgt ccattgccag gaagaggctt 421 gtgccgttat tctgctggaa catggtgcca atccaaacct taaggatatc tacggcaaca 481 ctgctctcca ttatgctgtg tatagtgaga gcacctcact ggcagaaaaa ctgcttttcc 541 atggtgaaaa tattgaagca ctggacaagg tatagatcaa tcaactttct ttccaaaata 601 tttgttttaa cattgacata ggtaagggtc aa //