LOCUS BC121138 1418 bp mRNA linear HUM 18-MAR-2009
DEFINITION Homo sapiens UBA domain containing 2, mRNA (cDNA clone
IMAGE:40120986), complete cds.
ACCESSION BC121138
VERSION BC121138.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1418)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1418)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (02-AUG-2006) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Baylor Human Genome Sequencing Center
cDNA Library Preparation: Baylor Human Genome Sequencing Center
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAM Plate: 29 Row: h Column: 11
This clone has the following problem: The cds is short compared to
the longest cds in the locus.
FEATURES Location/Qualifiers
source 1..1418
/db_xref="H-InvDB:HIT000388335"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:40120986"
/tissue_type="PCR rescued clones"
/clone_lib="NIH_MGC_283"
/note="Vector: pCR-Blunt II-TOPO with reversed insert;
Clone identification sequence tag: TATAACCA sequenced from
the forward primer"
gene 1..1418
/gene="UBAC2"
/db_xref="GeneID:337867"
/db_xref="HGNC:HGNC:20486"
CDS 617..1090
/gene="UBAC2"
/codon_start=1
/product="UBAC2 protein"
/protein_id="AAI21139.1"
/db_xref="GeneID:337867"
/db_xref="HGNC:HGNC:20486"
/translation="MSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEA
RIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVN
YQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH"
BASE COUNT 321 a 346 c 361 g 390 t
ORIGIN
1 atgccccatt cttttgggct tgggggaccg aactaactcc ccccgccccc acttgcaaag
61 ttcagcctcc gctttagaag ctgacctctc agtttcactt ggatgtgttt cttcttcagt
121 ctccaagaag agtttttaga caaacacaca ctgatgagag tgctttcaag tggagggaag
181 ttaggaagtc gtggcgaggg agcgcagctg tgctgctgga tgttgctgtt ttcctggcgt
241 gttagcggtg gtcagcagac aaggcgcctc tgtcgaagag ccttctgctg gtccccagtg
301 ccctctccct cctgctcgcc ctcctcctgc ctcactgcca gaagctcttt gtgtatgacc
361 ttcacgcagt caagaacgac ttccagattt ggaggttgat atgtggaaga ataatttgcc
421 ttgatttgaa agatactttc tgcagtagtc tgcttattta taattttagg atatttgaaa
481 gaagatatgg aagcagaaaa tttgcatcct ttttgctggg ttcctgggtt ttgtcagcct
541 tatttgactt tctcctcatt gaagctatgc agtatttctt tggcatcact gcagctagta
601 atttgccttc tggattatgt ccggtctgtg ctacgacagc aaaatgttcc aggtgcatca
661 ggtgctctgc atccccagct ggatggcaaa attcttttct tggacacttg aacccatctt
721 ctcttcttca gaacccacca gcgaagccag aattgggatg ggagccacgc tggacatcca
781 gagacagcag agaatggagc tgctggaccg gcagctgatg ttctctcagt ttgcacaagg
841 gaggcgacag agacagcagc agggaggaat gatcaattgg aatcgtcttt ttcctccttt
901 acgtcagcga caaaacgtaa actatcaggg cggtcggcag tctgagccag cagcgccccc
961 tctagaagtt tctgaggaac aggtcgcccg gctcatggag atgggatttt ccagaggtga
1021 tgctttggaa gccctgagag cttcaaacaa tgacctcaat gtcgccacca acttcctgct
1081 gcagcactga tagtcccagg ccaacactgg gaccggaccg gcagccgagt gacagtgcgt
1141 ggtccccacc atcagatcag cccggggacc gagcatctct ggtgctgatg ttcttgtggg
1201 aagagggagg ttccaccgca cccctgccct caaccgcaag actgttgccg ttttagtgtg
1261 gagataagtt tgccattaca ttagcatgta ttttctatct atatttttta ttgggcattt
1321 tccctaggtt ggagagtcag cactcgtttt gaatgtgttt aaaatgcatt aaaatggaag
1381 atttctgcag gcagttgaat ggcactccag atggggaa
//