LOCUS BC119751 694 bp mRNA linear HUM 04-OCT-2006 DEFINITION Homo sapiens CXXC finger 4, mRNA (cDNA clone MGC:149872 IMAGE:40119265), complete cds. ACCESSION BC119751 VERSION BC119751.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 694) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 694) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (11-JUL-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 27 Row: p Column: 3. FEATURES Location/Qualifiers source 1..694 /db_xref="H-InvDB:HIT000388070" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:149872 IMAGE:40119265" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: TGTCATAT sequenced from the reverse primer" gene 1..694 /gene="CXXC4" /gene_synonym="IDAX" /db_xref="GeneID:80319" /db_xref="HGNC:HGNC:24593" CDS 16..612 /gene="CXXC4" /gene_synonym="IDAX" /codon_start=1 /product="CXXC finger 4" /protein_id="AAI19752.1" /db_xref="GeneID:80319" /db_xref="HGNC:HGNC:24593" /translation="MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGEC MNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSA FQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNR KTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF" BASE COUNT 181 a 193 c 175 g 145 t ORIGIN 1 ggcggcagga ccagcatgca ccaccgaaac gactcccaga ggctggggaa agctggctgc 61 ccgccagagc cgtcgttgca aatggcaaat actaatttcc tctccacctt atcccctgaa 121 cactgcagac ctttggcggg ggaatgcatg aacaagctca aatgcggcgc tgctgaagca 181 gagataatga atctccccga gcgcgtgggg actttttccg ctatcccggc tttagggggc 241 atctcattac ctccaggggt catcgtcatg acagcccttc actcccccgc agcagcctca 301 gcagccgtca cagacagtgc gtttcaaatt gccaatctgg cagactgccc gcagaatcat 361 tcctcctcct cctcgtcctc ctcaggggga gctggcggag ccaacccagc caagaagaag 421 aggaaaaggt gtggggtctg cgtgccctgc aagaggctca tcaactgtgg cgtctgcagc 481 agttgcagga accgcaaaac gggacaccag atctgcaaat ttagaaaatg tgaagagcta 541 aagaaaaaac ctggcacttc actagagaga acacctgttc ccagcgctga agcattccga 601 tggttctttt aaagcagtag tatatcttat tttcaaggca tttggaaatg aagggcaaac 661 taatgtcttg ttttaagaaa ctgcttagtc cacc //