LOCUS       BC119751                 694 bp    mRNA    linear   HUM 04-OCT-2006
DEFINITION  Homo sapiens CXXC finger 4, mRNA (cDNA clone MGC:149872
            IMAGE:40119265), complete cds.
ACCESSION   BC119751
VERSION     BC119751.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 694)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 694)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 27 Row: p Column: 3.
FEATURES             Location/Qualifiers
     source          1..694
                     /db_xref="H-InvDB:HIT000388070"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:149872 IMAGE:40119265"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: TGTCATAT sequenced from the reverse primer"
     gene            1..694
                     /gene="CXXC4"
                     /gene_synonym="IDAX"
                     /db_xref="GeneID:80319"
                     /db_xref="HGNC:HGNC:24593"
     CDS             16..612
                     /gene="CXXC4"
                     /gene_synonym="IDAX"
                     /codon_start=1
                     /product="CXXC finger 4"
                     /protein_id="AAI19752.1"
                     /db_xref="GeneID:80319"
                     /db_xref="HGNC:HGNC:24593"
                     /translation="MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGEC
                     MNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSA
                     FQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNR
                     KTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF"
BASE COUNT          181 a          193 c          175 g          145 t
ORIGIN      
        1 ggcggcagga ccagcatgca ccaccgaaac gactcccaga ggctggggaa agctggctgc
       61 ccgccagagc cgtcgttgca aatggcaaat actaatttcc tctccacctt atcccctgaa
      121 cactgcagac ctttggcggg ggaatgcatg aacaagctca aatgcggcgc tgctgaagca
      181 gagataatga atctccccga gcgcgtgggg actttttccg ctatcccggc tttagggggc
      241 atctcattac ctccaggggt catcgtcatg acagcccttc actcccccgc agcagcctca
      301 gcagccgtca cagacagtgc gtttcaaatt gccaatctgg cagactgccc gcagaatcat
      361 tcctcctcct cctcgtcctc ctcaggggga gctggcggag ccaacccagc caagaagaag
      421 aggaaaaggt gtggggtctg cgtgccctgc aagaggctca tcaactgtgg cgtctgcagc
      481 agttgcagga accgcaaaac gggacaccag atctgcaaat ttagaaaatg tgaagagcta
      541 aagaaaaaac ctggcacttc actagagaga acacctgttc ccagcgctga agcattccga
      601 tggttctttt aaagcagtag tatatcttat tttcaaggca tttggaaatg aagggcaaac
      661 taatgtcttg ttttaagaaa ctgcttagtc cacc
//