LOCUS BC119725 530 bp mRNA linear HUM 04-OCT-2006 DEFINITION Homo sapiens cortistatin, mRNA (cDNA clone MGC:149757 IMAGE:40118117), complete cds. ACCESSION BC119725 VERSION BC119725.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 530) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 530) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (11-JUL-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 27 Row: k Column: 18. FEATURES Location/Qualifiers source 1..530 /db_xref="H-InvDB:HIT000388044" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:149757 IMAGE:40118117" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_283" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: CGACCTAT sequenced from the forward primer" gene 1..530 /gene="CORT" /gene_synonym="CST-14" /gene_synonym="CST-17" /gene_synonym="CST-29" /db_xref="GeneID:1325" /db_xref="HGNC:HGNC:2257" /db_xref="MIM:602784" CDS 36..503 /gene="CORT" /gene_synonym="CST-14" /gene_synonym="CST-17" /gene_synonym="CST-29" /codon_start=1 /product="cortistatin" /protein_id="AAI19726.1" /db_xref="GeneID:1325" /db_xref="HGNC:HGNC:2257" /db_xref="MIM:602784" /translation="MYRHKNSWRLGLKYPPSSKEETQVPKTLISGLPGRKSSSRVGEK LQSAHKMPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAW WFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK" BASE COUNT 135 a 161 c 157 g 77 t ORIGIN 1 gcgagggaag agggaagagg atccaggcgt tagacatgta tagacacaaa aacagctgga 61 gattgggctt aaaataccca ccaagctcca aagaagagac ccaagtcccc aaaacattga 121 tttcagggct gccaggaagg aagagcagca gcagggtggg agagaagctc cagtcagccc 181 acaagatgcc attgtccccc ggcctcctgc tgctgctgct ctccggggcc acggccaccg 241 ctgccctgcc cctggagggt ggccccaccg gccgagacag cgagcatatg caggaagcgg 301 caggaataag gaaaagcagc ctcctgactt tcctcgcttg gtggtttgag tggacctccc 361 aggccagtgc cgggcccctc ataggagagg aagcccggga ggtggccagg cggcaggaag 421 gcgcaccccc ccagcaatcc gcgcgccggg acagaatgcc ctgcaggaac ttcttctgga 481 agaccttctc ctcctgcaaa taaaacctca cccatgaatg ctcacgcaag //