LOCUS       BC119725                 530 bp    mRNA    linear   HUM 04-OCT-2006
DEFINITION  Homo sapiens cortistatin, mRNA (cDNA clone MGC:149757
            IMAGE:40118117), complete cds.
ACCESSION   BC119725
VERSION     BC119725.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 530)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 530)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 27 Row: k Column: 18.
FEATURES             Location/Qualifiers
     source          1..530
                     /db_xref="H-InvDB:HIT000388044"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:149757 IMAGE:40118117"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_283"
                     /note="Vector: pCR-Blunt II-TOPO with reversed insert;
                     Clone identification sequence tag: CGACCTAT sequenced from
                     the forward primer"
     gene            1..530
                     /gene="CORT"
                     /gene_synonym="CST-14"
                     /gene_synonym="CST-17"
                     /gene_synonym="CST-29"
                     /db_xref="GeneID:1325"
                     /db_xref="HGNC:HGNC:2257"
                     /db_xref="MIM:602784"
     CDS             36..503
                     /gene="CORT"
                     /gene_synonym="CST-14"
                     /gene_synonym="CST-17"
                     /gene_synonym="CST-29"
                     /codon_start=1
                     /product="cortistatin"
                     /protein_id="AAI19726.1"
                     /db_xref="GeneID:1325"
                     /db_xref="HGNC:HGNC:2257"
                     /db_xref="MIM:602784"
                     /translation="MYRHKNSWRLGLKYPPSSKEETQVPKTLISGLPGRKSSSRVGEK
                     LQSAHKMPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAW
                     WFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK"
BASE COUNT          135 a          161 c          157 g           77 t
ORIGIN      
        1 gcgagggaag agggaagagg atccaggcgt tagacatgta tagacacaaa aacagctgga
       61 gattgggctt aaaataccca ccaagctcca aagaagagac ccaagtcccc aaaacattga
      121 tttcagggct gccaggaagg aagagcagca gcagggtggg agagaagctc cagtcagccc
      181 acaagatgcc attgtccccc ggcctcctgc tgctgctgct ctccggggcc acggccaccg
      241 ctgccctgcc cctggagggt ggccccaccg gccgagacag cgagcatatg caggaagcgg
      301 caggaataag gaaaagcagc ctcctgactt tcctcgcttg gtggtttgag tggacctccc
      361 aggccagtgc cgggcccctc ataggagagg aagcccggga ggtggccagg cggcaggaag
      421 gcgcaccccc ccagcaatcc gcgcgccggg acagaatgcc ctgcaggaac ttcttctgga
      481 agaccttctc ctcctgcaaa taaaacctca cccatgaatg ctcacgcaag
//