LOCUS       BC119706                 455 bp    mRNA    linear   HUM 04-OCT-2006
DEFINITION  Homo sapiens defensin, alpha 3, neutrophil-specific, mRNA (cDNA
            clone MGC:149652 IMAGE:40117146), complete cds.
ACCESSION   BC119706
VERSION     BC119706.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 455)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 455)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Oct 4, 2006 this sequence version replaced BC119706.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 27 Row: h Column: 6.
FEATURES             Location/Qualifiers
     source          1..455
                     /db_xref="H-InvDB:HIT000388025"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:149652 IMAGE:40117146"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_283"
                     /note="Vector: pCR-Blunt II-TOPO with reversed insert;
                     Clone identification sequence tag: CGAACTCT sequenced from
                     the forward primer"
     gene            1..455
                     /gene="DEFA3"
                     /gene_synonym="HNP-3"
                     /gene_synonym="HNP3"
                     /gene_synonym="HP-3"
                     /db_xref="GeneID:1668"
                     /db_xref="HGNC:HGNC:2762"
                     /db_xref="MIM:604522"
     CDS             71..355
                     /gene="DEFA3"
                     /gene_synonym="HNP-3"
                     /gene_synonym="HNP3"
                     /gene_synonym="HP-3"
                     /codon_start=1
                     /product="defensin, alpha 3, neutrophil-specific"
                     /protein_id="AAI19707.1"
                     /db_xref="GeneID:1668"
                     /db_xref="HGNC:HGNC:2762"
                     /db_xref="MIM:604522"
                     /translation="MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVV
                     VSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC"
BASE COUNT          106 a          128 c          116 g          105 t
ORIGIN      
        1 cctgggacag aggactgctg tctgccctct ctggtcaccc tgcctagcta gaggatctgt
       61 gaccccagcc atgaggaccc tcgccatcct tgctgccatt ctcctggtgg ccctgcaggc
      121 ccaggctgag ccactccagg caagagctga tgaggttgct gcagccccgg agcagattgc
      181 agcggacatc ccagaagtgg ttgtttccct tgcatgggac gaaagcttgg ctccaaagca
      241 tccaggctca aggaaaaaca tggactgcta ttgcagaata ccagcgtgca ttgcaggaga
      301 acgtcgctat ggaacctgca tctaccaggg aagactctgg gcattctgct gctgagcttg
      361 cagaaaaaga aaaatgagct caaaatttgc tttgagagct acagggaatt gctattactc
      421 ctgtaccttc tgctcaattt cctttcctca tctca
//