LOCUS BC119706 455 bp mRNA linear HUM 04-OCT-2006 DEFINITION Homo sapiens defensin, alpha 3, neutrophil-specific, mRNA (cDNA clone MGC:149652 IMAGE:40117146), complete cds. ACCESSION BC119706 VERSION BC119706.2 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 455) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 455) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (11-JUL-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Oct 4, 2006 this sequence version replaced BC119706.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 27 Row: h Column: 6. FEATURES Location/Qualifiers source 1..455 /db_xref="H-InvDB:HIT000388025" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:149652 IMAGE:40117146" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_283" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: CGAACTCT sequenced from the forward primer" gene 1..455 /gene="DEFA3" /gene_synonym="HNP-3" /gene_synonym="HNP3" /gene_synonym="HP-3" /db_xref="GeneID:1668" /db_xref="HGNC:HGNC:2762" /db_xref="MIM:604522" CDS 71..355 /gene="DEFA3" /gene_synonym="HNP-3" /gene_synonym="HNP3" /gene_synonym="HP-3" /codon_start=1 /product="defensin, alpha 3, neutrophil-specific" /protein_id="AAI19707.1" /db_xref="GeneID:1668" /db_xref="HGNC:HGNC:2762" /db_xref="MIM:604522" /translation="MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVV VSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC" BASE COUNT 106 a 128 c 116 g 105 t ORIGIN 1 cctgggacag aggactgctg tctgccctct ctggtcaccc tgcctagcta gaggatctgt 61 gaccccagcc atgaggaccc tcgccatcct tgctgccatt ctcctggtgg ccctgcaggc 121 ccaggctgag ccactccagg caagagctga tgaggttgct gcagccccgg agcagattgc 181 agcggacatc ccagaagtgg ttgtttccct tgcatgggac gaaagcttgg ctccaaagca 241 tccaggctca aggaaaaaca tggactgcta ttgcagaata ccagcgtgca ttgcaggaga 301 acgtcgctat ggaacctgca tctaccaggg aagactctgg gcattctgct gctgagcttg 361 cagaaaaaga aaaatgagct caaaatttgc tttgagagct acagggaatt gctattactc 421 ctgtaccttc tgctcaattt cctttcctca tctca //