LOCUS BC119626 557 bp mRNA linear HUM 09-JUN-2008 DEFINITION Homo sapiens sorting nexin 20, mRNA (cDNA clone IMAGE:40115502), complete cds. ACCESSION BC119626 VERSION BC119626.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 557) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 557) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (11-JUL-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 27 Row: a Column: 6 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..557 /db_xref="H-InvDB:HIT000387945" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40115502" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: TATCAAAA sequenced from the reverse primer" gene 1..557 /gene="SNX20" /gene_synonym="SLIC-1" /gene_synonym="SLIC1" /db_xref="GeneID:124460" /db_xref="HGNC:HGNC:30390" CDS 27..485 /gene="SNX20" /gene_synonym="SLIC-1" /gene_synonym="SLIC1" /codon_start=1 /product="SNX20 protein" /protein_id="AAI19627.1" /db_xref="GeneID:124460" /db_xref="HGNC:HGNC:30390" /translation="MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLD THSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ TGSFDNNKAVLERRYSDFVTLQERLEESQLRRPTPRGITLKELTVREYLH" BASE COUNT 130 a 170 c 166 g 91 t ORIGIN 1 agccctggag actggagcct tggagcatgg caagtccaga gcaccctggg agccctggct 61 gcatgggacc cataacccag tgcacggcaa ggacccagca ggaagcacca gccactggcc 121 ccgacctccc gcacccagga cctgacgggc acttagacac acacagtggc ctgagctcca 181 actccagcat gaccacgcgg gagcttcagc agtactggca gaaccagaaa tgccgctgga 241 agcacgtcaa actgctcttt gagatcgctt cagctcgcat cgaggagaga aaagtctcta 301 agtttgtggt gtaccaaatc atcgtcatcc agactgggag ctttgacaac aacaaggccg 361 tcctggaacg gcgctattcc gacttcgtga ctctgcagga gaggctggag gagagccagc 421 tccggaggcc cacgccccga ggcatcaccc tgaaggagct cactgtgcga gaatacctgc 481 actgagccgg cctgggaccc cgcagggacg ctggagattt ggggtcacca tggctcacag 541 tgggctgttt ggggttc //