LOCUS       BC119626                 557 bp    mRNA    linear   HUM 09-JUN-2008
DEFINITION  Homo sapiens sorting nexin 20, mRNA (cDNA clone IMAGE:40115502),
            complete cds.
ACCESSION   BC119626
VERSION     BC119626.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 557)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 557)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 27 Row: a Column: 6
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..557
                     /db_xref="H-InvDB:HIT000387945"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40115502"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: TATCAAAA sequenced from the reverse primer"
     gene            1..557
                     /gene="SNX20"
                     /gene_synonym="SLIC-1"
                     /gene_synonym="SLIC1"
                     /db_xref="GeneID:124460"
                     /db_xref="HGNC:HGNC:30390"
     CDS             27..485
                     /gene="SNX20"
                     /gene_synonym="SLIC-1"
                     /gene_synonym="SLIC1"
                     /codon_start=1
                     /product="SNX20 protein"
                     /protein_id="AAI19627.1"
                     /db_xref="GeneID:124460"
                     /db_xref="HGNC:HGNC:30390"
                     /translation="MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLD
                     THSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ
                     TGSFDNNKAVLERRYSDFVTLQERLEESQLRRPTPRGITLKELTVREYLH"
BASE COUNT          130 a          170 c          166 g           91 t
ORIGIN      
        1 agccctggag actggagcct tggagcatgg caagtccaga gcaccctggg agccctggct
       61 gcatgggacc cataacccag tgcacggcaa ggacccagca ggaagcacca gccactggcc
      121 ccgacctccc gcacccagga cctgacgggc acttagacac acacagtggc ctgagctcca
      181 actccagcat gaccacgcgg gagcttcagc agtactggca gaaccagaaa tgccgctgga
      241 agcacgtcaa actgctcttt gagatcgctt cagctcgcat cgaggagaga aaagtctcta
      301 agtttgtggt gtaccaaatc atcgtcatcc agactgggag ctttgacaac aacaaggccg
      361 tcctggaacg gcgctattcc gacttcgtga ctctgcagga gaggctggag gagagccagc
      421 tccggaggcc cacgccccga ggcatcaccc tgaaggagct cactgtgcga gaatacctgc
      481 actgagccgg cctgggaccc cgcagggacg ctggagattt ggggtcacca tggctcacag
      541 tgggctgttt ggggttc
//