LOCUS BC117515 587 bp mRNA linear HUM 04-OCT-2006 DEFINITION Homo sapiens inositol polyphosphate-5-phosphatase, 40kDa, mRNA (cDNA clone IMAGE:40006845), complete cds. ACCESSION BC117515 VERSION BC117515.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 587) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 587) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (02-JUN-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 2 Row: n Column: 19 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..587 /db_xref="H-InvDB:HIT000387789" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40006845" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: TGTTCCAC sequenced from the reverse primer" gene 1..587 /gene="INPP5A" /gene_synonym="5PTASE" /db_xref="GeneID:3632" /db_xref="HGNC:HGNC:6076" /db_xref="MIM:600106" CDS 141..236 /gene="INPP5A" /gene_synonym="5PTASE" /codon_start=1 /product="INPP5A protein" /protein_id="AAI17516.1" /db_xref="GeneID:3632" /db_xref="HGNC:HGNC:6076" /db_xref="MIM:600106" /translation="MGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ" BASE COUNT 130 a 163 c 167 g 127 t ORIGIN 1 cccagcggat ctaatggctg cgcgcgggcc gctgtgaggc gcggcggcga gcgacgggcg 61 cggggccgcg gagcagcgag cgagcgagcg agagcgagga gaaggttgtc acctatgacc 121 acattgggcc caacgtctgc atgggagacc acaagcccgt gttcctggcc ttccgaatca 181 tgcccggggc aggtaaacct catgcccatg tgcacaagtg ttgtgtcgtg cagtgacgtg 241 gtgggaagag atgccagcgc cacgagagga cacttcgtga gcctccctgt agccgtggac 301 cgaatacgca ctcttgaaag ctgcatcgag aacccgccca agcgccacct gctagacggc 361 cagccccaca cttcgcttca gcctccggac cattccggag cagcctcaca tacctcactg 421 tctcgtctgt ctatgtgaca ttaagtagaa atattggttt tttttttttt ttaaataagt 481 cacagtcctg ttgtcaaaac tctaatagac agcaaagagg gtctgtaccg tagacttcac 541 agttttcagt ttttaatgat tgccagtgga ggggcttctt cagcaca //