LOCUS       BC117515                 587 bp    mRNA    linear   HUM 04-OCT-2006
DEFINITION  Homo sapiens inositol polyphosphate-5-phosphatase, 40kDa, mRNA
            (cDNA clone IMAGE:40006845), complete cds.
ACCESSION   BC117515
VERSION     BC117515.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 587)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 587)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 2 Row: n Column: 19
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..587
                     /db_xref="H-InvDB:HIT000387789"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40006845"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: TGTTCCAC sequenced from the reverse primer"
     gene            1..587
                     /gene="INPP5A"
                     /gene_synonym="5PTASE"
                     /db_xref="GeneID:3632"
                     /db_xref="HGNC:HGNC:6076"
                     /db_xref="MIM:600106"
     CDS             141..236
                     /gene="INPP5A"
                     /gene_synonym="5PTASE"
                     /codon_start=1
                     /product="INPP5A protein"
                     /protein_id="AAI17516.1"
                     /db_xref="GeneID:3632"
                     /db_xref="HGNC:HGNC:6076"
                     /db_xref="MIM:600106"
                     /translation="MGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ"
BASE COUNT          130 a          163 c          167 g          127 t
ORIGIN      
        1 cccagcggat ctaatggctg cgcgcgggcc gctgtgaggc gcggcggcga gcgacgggcg
       61 cggggccgcg gagcagcgag cgagcgagcg agagcgagga gaaggttgtc acctatgacc
      121 acattgggcc caacgtctgc atgggagacc acaagcccgt gttcctggcc ttccgaatca
      181 tgcccggggc aggtaaacct catgcccatg tgcacaagtg ttgtgtcgtg cagtgacgtg
      241 gtgggaagag atgccagcgc cacgagagga cacttcgtga gcctccctgt agccgtggac
      301 cgaatacgca ctcttgaaag ctgcatcgag aacccgccca agcgccacct gctagacggc
      361 cagccccaca cttcgcttca gcctccggac cattccggag cagcctcaca tacctcactg
      421 tctcgtctgt ctatgtgaca ttaagtagaa atattggttt tttttttttt ttaaataagt
      481 cacagtcctg ttgtcaaaac tctaatagac agcaaagagg gtctgtaccg tagacttcac
      541 agttttcagt ttttaatgat tgccagtgga ggggcttctt cagcaca
//