LOCUS       BC113093                 495 bp    mRNA    linear   HUM 16-AUG-2008
DEFINITION  Homo sapiens amine oxidase (flavin containing) domain 1, mRNA (cDNA
            clone IMAGE:40075842), complete cds.
ACCESSION   BC113093
VERSION     BC113093.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 495)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 495)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2006) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 18 Row: n Column: 19
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..495
                     /db_xref="H-InvDB:HIT000386793"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40075842"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_283"
                     /note="Vector: pCR-Blunt II-TOPO with reversed insert;
                     Clone identification sequence tag: CTCAACAA sequenced from
                     the forward primer"
     gene            1..495
                     /gene="AOF1"
                     /gene_synonym="bA204B7.3"
                     /gene_synonym="dJ298J15.2"
                     /db_xref="GeneID:221656"
                     /db_xref="HGNC:HGNC:21577"
     CDS             104..445
                     /gene="AOF1"
                     /gene_synonym="bA204B7.3"
                     /gene_synonym="dJ298J15.2"
                     /codon_start=1
                     /product="AOF1 protein"
                     /protein_id="AAI13094.1"
                     /db_xref="GeneID:221656"
                     /db_xref="HGNC:HGNC:21577"
                     /translation="MSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYF
                     VTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLS
                     GVREASKIAAF"
BASE COUNT          122 a          122 c          149 g          102 t
ORIGIN      
        1 atgggcaggg cggagcgagc gctgcggcta aagcgaaggc ggggacccta cccatcccta
       61 gtcctgtcgg ctcctcccac cccagaagaa gcacagcgtg ctgatgtctg tgattgccgg
      121 ggaggctgtc gcatccgtga ggaccctgga cgacaaacag gtgctgcagc agtgcatggc
      181 cacgctccgg gagctgttca aggagcagga ggtcccagat cccacaaagt attttgtcac
      241 tcggtggagc acagacccat ggatccagat ggcatacagt tttgtgaaga caggtggaag
      301 tggggaggcc tacgatatca ttgctgaaga cattcaagga accgtctttt tcgctggtga
      361 ggcaacaaac aggcatttcc cacaaactgt tacaggggca tatttgagtg gcgttcgaga
      421 agcaagcaag attgcagcat tttaagaatt cggtggaccc agctttcttc tgtaccccag
      481 atggggaaat ttgaa
//