LOCUS BC113093 495 bp mRNA linear HUM 16-AUG-2008 DEFINITION Homo sapiens amine oxidase (flavin containing) domain 1, mRNA (cDNA clone IMAGE:40075842), complete cds. ACCESSION BC113093 VERSION BC113093.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 495) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 495) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (02-FEB-2006) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 18 Row: n Column: 19 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..495 /db_xref="H-InvDB:HIT000386793" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40075842" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_283" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: CTCAACAA sequenced from the forward primer" gene 1..495 /gene="AOF1" /gene_synonym="bA204B7.3" /gene_synonym="dJ298J15.2" /db_xref="GeneID:221656" /db_xref="HGNC:HGNC:21577" CDS 104..445 /gene="AOF1" /gene_synonym="bA204B7.3" /gene_synonym="dJ298J15.2" /codon_start=1 /product="AOF1 protein" /protein_id="AAI13094.1" /db_xref="GeneID:221656" /db_xref="HGNC:HGNC:21577" /translation="MSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYF VTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLS GVREASKIAAF" BASE COUNT 122 a 122 c 149 g 102 t ORIGIN 1 atgggcaggg cggagcgagc gctgcggcta aagcgaaggc ggggacccta cccatcccta 61 gtcctgtcgg ctcctcccac cccagaagaa gcacagcgtg ctgatgtctg tgattgccgg 121 ggaggctgtc gcatccgtga ggaccctgga cgacaaacag gtgctgcagc agtgcatggc 181 cacgctccgg gagctgttca aggagcagga ggtcccagat cccacaaagt attttgtcac 241 tcggtggagc acagacccat ggatccagat ggcatacagt tttgtgaaga caggtggaag 301 tggggaggcc tacgatatca ttgctgaaga cattcaagga accgtctttt tcgctggtga 361 ggcaacaaac aggcatttcc cacaaactgt tacaggggca tatttgagtg gcgttcgaga 421 agcaagcaag attgcagcat tttaagaatt cggtggaccc agctttcttc tgtaccccag 481 atggggaaat ttgaa //