LOCUS       BC106911                 484 bp    mRNA    linear   HUM 17-SEP-2007
DEFINITION  Homo sapiens transmembrane protein 98, mRNA (cDNA clone
            IMAGE:40031873), partial cds.
ACCESSION   BC106911
VERSION     BC106911.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 484)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 484)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Nov 1, 2006 this sequence version replaced BC106911.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 14 Row: b Column: 24.
FEATURES             Location/Qualifiers
     source          1..484
                     /db_xref="H-InvDB:HIT000338549"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40031873"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_283"
                     /note="Vector: pCR-Blunt II-TOPO with reversed insert;
                     Clone identification sequence tag: NA"
     gene            <1..484
                     /gene="TMEM98"
                     /gene_synonym="DKFZP564K1964"
                     /db_xref="GeneID:26022"
                     /db_xref="HGNC:HGNC:24529"
     CDS             <1..288
                     /gene="TMEM98"
                     /gene_synonym="DKFZP564K1964"
                     /codon_start=1
                     /product="TMEM98 protein"
                     /protein_id="AAI06912.1"
                     /db_xref="GeneID:26022"
                     /db_xref="HGNC:HGNC:24529"
                     /translation="LAITSHRVDDVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRN
                     ACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSAI"
BASE COUNT           96 a          134 c          135 g          119 t
ORIGIN      
        1 cttgccatca ccagccacag ggtggatgat gttgtgaagt cgatgtaccc tccgttggac
       61 cccaaactcc tggacgcacg gacgactgcc ctgctcctgt ctgtcagtca cctggtgctg
      121 gtgacaagga atgcctgcca tctgacggga ggcctggact ggattgacca gtctctgtcg
      181 gctgctgagg agcatttgga agtccttcga gaagcagccc tagcttctga gccagataaa
      241 ggcctcccag gccctgaagg cttcctgcag gagcagtctg caatttagtg cctacaggcc
      301 agcagctagc catgaaggcc cctgccgcca tccctggatg gctcagctta gccttctact
      361 ttttcctata gagttagttg ttctccacgg ctggagagtt cagctgtgtg tgcatagtaa
      421 agcaggagat ccccgtcagt ttatgcctct tttgcagttg caaactgtgg ctggtgatgg
      481 caag
//