LOCUS BC104634 935 bp mRNA linear HUM 23-JUL-2007
DEFINITION Homo sapiens nucleoredoxin, mRNA (cDNA clone IMAGE:4689777),
complete cds.
ACCESSION BC104634
VERSION BC104634.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 935)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 935)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (09-SEP-2005) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: CLONTECH
cDNA Library Preparation: CLONTECH Laboratories, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: National Institutes of Health Intramural
Sequencing Center (NISC),
Gaithersburg, Maryland;
Web site: http://www.nisc.nih.gov/
Contact: nisc_mgc@nhgri.nih.gov
Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
Young,A., Zhang,L.-H. and Green,E.D.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 61 Row: e Column: 11
This clone has the following problem: The cds is short compared to
the longest cds in the locus.
FEATURES Location/Qualifiers
source 1..935
/db_xref="H-InvDB:HIT000337784"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:4689777"
/tissue_type="Lung"
/clone_lib="NIH_MGC_77"
/lab_host="DH10B"
/note="Vector: pDNR-LIB"
gene 1..935
/gene="NXN"
/gene_synonym="TRG-4"
/db_xref="GeneID:64359"
/db_xref="HGNC:HGNC:18008"
CDS 113..646
/gene="NXN"
/gene_synonym="TRG-4"
/codon_start=1
/product="NXN protein"
/protein_id="AAI04635.1"
/db_xref="GeneID:64359"
/db_xref="HGNC:HGNC:18008"
/translation="MQELRNSLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDD
PEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVL
VESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQ
GRRSRPRLRVAPGNLLT"
BASE COUNT 238 a 230 c 260 g 207 t
ORIGIN
1 ggggattacg gagtccgtgt atctgccgcg gggactttcc taggagaggc gtcactgcaa
61 caggtctagg aggggactgg cttgggaaaa aaagaagaat attgtgtgtg atatgcagga
121 actgagaaat agcctcaaac tttggaacaa ataccgaatt tccaacattc catcactaat
181 attcctcgac gccaccactg ggaaggttgt gtgcaggaac gggctgctgg tgatccgaga
241 tgacccagaa ggtctggagt tcccctgggg accgaaaccc ttcagggaag tcattgcagg
301 gcccttgctt agaaacaatg ggcagtctct ggagagcagc agcctggagg ggtctcacgt
361 gggcgtctat ttctccgcac attggtgtcc gccctgccga agcctcaccc gggtcctggt
421 ggaatcctac cggaagatca aggaggcagg ccagaacttc gagatcatct tcgttagtgc
481 agacaggtcg gaggagtcct tcaaacagta cttcagtgag atgccctggc tcgccgtccc
541 ctacacggat gaggcccggc ggtcgcgcct caaccggctg tacggaatcc aaggtaggcg
601 ctccaggccc cggctccgtg tggctcctgg aaacctgctc acctgagctc accgtgtctt
661 tggctttcct ttaagaagaa gagcatcatt atttccatga atattcatgt gcctttcatg
721 tttctcagca gtgtagaatt ttcatggtgt gaattctaag ccatttttaa aaaataagta
781 ttgtcaggcc gggcatggca gctcacactg taaccccagc actttgggag gctgaggcgg
841 gtggatcacc tgggctcagg agttcgagac cggtttggac aacacggtgg agcccggtct
901 ctaccaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa
//