LOCUS BC103859 884 bp mRNA linear HUM 04-OCT-2006
DEFINITION Homo sapiens BRF1 homolog, subunit of RNA polymerase III
transcription initiation factor IIIB (S. cerevisiae), mRNA (cDNA
clone IMAGE:40003193), complete cds.
ACCESSION BC103859
VERSION BC103859.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 884)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
CONSRTM Mammalian Gene Collection Program Team
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 884)
CONSRTM NIH MGC Project
TITLE Direct Submission
JOURNAL Submitted (07-SEP-2005) National Institutes of Health, Mammalian
Gene Collection (MGC), Bethesda, MD 20892-2590, USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Baylor Human Genome Sequencing Center
cDNA Library Preparation: Baylor Human Genome Sequencing Center
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAM Plate: 5 Row: c Column: 9
This clone has the following problem: The cds is short compared to
the longest cds in the locus.
FEATURES Location/Qualifiers
source 1..884
/db_xref="H-InvDB:HIT000337411"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:40003193"
/tissue_type="PCR rescued clones"
/clone_lib="NIH_MGC_283"
/note="Vector: pCR-Blunt II-TOPO with reversed insert;
Clone identification sequence tag: AGCACAAC sequenced from
the forward primer"
gene 1..884
/gene="BRF1"
/gene_synonym="BRF"
/gene_synonym="hBRF"
/gene_synonym="TAFIII90"
/gene_synonym="TF3B90"
/gene_synonym="TFIIIB90"
/db_xref="GeneID:2972"
/db_xref="HGNC:HGNC:11551"
/db_xref="MIM:604902"
CDS 397..801
/gene="BRF1"
/gene_synonym="BRF"
/gene_synonym="hBRF"
/gene_synonym="TAFIII90"
/gene_synonym="TF3B90"
/gene_synonym="TFIIIB90"
/codon_start=1
/product="BRF1 protein"
/protein_id="AAI03860.1"
/db_xref="GeneID:2972"
/db_xref="HGNC:HGNC:11551"
/db_xref="MIM:604902"
/translation="MTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKE
VISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPIEEGGQTEAREPPQ
ASSWEGPSTTRRRSQLWHGCPGCGRGGFTLCP"
BASE COUNT 199 a 243 c 281 g 161 t
ORIGIN
1 ccgccaagga cacacccacc gaggccacag ctgcgatttc atagtgtggg accccactgg
61 caaagacacg ctggctgctg tggccgtggt ttctgtccca gccgtctgtt tccatagaaa
121 aaggtaacgg gcataagcag tttccaggag aaatacaaat ggccagagtg gagacagcct
181 acatgtccat cagcaacaga aaggatcagc aggttgtggt gggtccattt ggggaatgca
241 gtgagaagga ataacttaca gcagcacaca agacctgggc gacagctgtc tccgggggtg
301 ccaggataga attgctgagc cgccagagac ccgtgcctgt atattccacg ctttgcgcac
361 ctgctggaat tcggggagaa gaaccacgag gtgtccatga ctgccctgag gctcctacag
421 aggatgaagc gggactggat gcacacaggc cggcgcccct cgggcctctg cggagcagcg
481 ctcctggttg cagccagaat gcatgacttc aggaggactg tgaaggaggt catcagtgtg
541 gtcaaagtgt gtgagtccac gctgcggaag aggctcacgg aatttgaaga cacccccacc
601 agtcagttga ccattgatga gttcatgaag atcgacctgg aggaggagtg cgaccccccc
661 atcgaggagg gagggcagac ggaggcccga gagcctcccc aggcctcttc gtgggaaggc
721 cccagtacca ctcgtaggag gtctcagctc tggcatggct gccccggatg tggccgaggg
781 ggcttcaccc tgtgtcctta ggagggggtg gccttgaggc agagccgtgc ctcactgacc
841 cccaggggcc tcatcctccc catggaatgg gctgtatgtc ctgc
//