LOCUS       BC103820                 766 bp    mRNA    linear   HUM 19-MAR-2007
DEFINITION  Homo sapiens transmembrane protein 185A, mRNA (cDNA clone
            IMAGE:40000937), partial cds.
ACCESSION   BC103820
VERSION     BC103820.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 766)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 766)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-SEP-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 5 Row: a Column: 16.
FEATURES             Location/Qualifiers
     source          1..766
                     /db_xref="H-InvDB:HIT000337372"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40000937"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: CGCACAAA sequenced from the reverse primer"
     gene            1..>766
                     /gene="TMEM185A"
                     /db_xref="GeneID:84548"
                     /db_xref="HGNC:HGNC:17125"
                     /db_xref="MIM:300483"
     CDS             37..>766
                     /gene="TMEM185A"
                     /codon_start=1
                     /product="TMEM185A protein"
                     /protein_id="AAI03821.1"
                     /db_xref="GeneID:84548"
                     /db_xref="HGNC:HGNC:17125"
                     /db_xref="MIM:300483"
                     /translation="MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVF
                     APIWLWKLMVIVGASVGTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVC
                     DRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRL
                     DKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWM
                     TIVVPLLTFEILLVHKLDGHNGNTK"
BASE COUNT          146 a          182 c          207 g          231 t
ORIGIN      
        1 gaggaggagg aggacgccgc ggtgaagttc tccgccatga acctgagggg cctcttccag
       61 gacttcaacc cgagtaaatt cctcatctat gcctgtctgc tgctgttctc tgtgctgctg
      121 gcccttcgtt tggatggcat catacagtgg agttactggg ctgtctttgc tccaatatgg
      181 ctgtggaagt taatggtcat tgttggagcc tcagttggaa ctggagtctg ggcacgaaat
      241 cctcaatatc gagcagaagg agaaacgtgt gtggagttta aagccatgtt gattgcagtg
      301 ggcatccact tgctcttgtt gatgtttgaa gttctggtct gtgacagaat cgagagagga
      361 agccatttct ggctcctggt cttcatgccg ctgttctttg tttccccggt gtctgttgca
      421 gcttgcgttt ggggctttcg acatgacagg tcactagagt tagaaatcct gtgttctgtc
      481 aacattctcc agtttatatt cattgcctta agactggaca agatcatcca ctggccctgg
      541 cttgttgtgt gtgtcccgct gtggattctc atgtcctttc tgtgcctggt ggtcctctac
      601 tacattgtgt ggtccgtctt gttcttgcgc tctatggatg tgattgcgga gcagcgcagg
      661 acacacataa ccatggccct gagctggatg accatcgtcg tgccccttct tacatttgag
      721 attctgctgg ttcacaaact ggatggccac aacggcaaca ccaagc
//