LOCUS BC103820 766 bp mRNA linear HUM 19-MAR-2007 DEFINITION Homo sapiens transmembrane protein 185A, mRNA (cDNA clone IMAGE:40000937), partial cds. ACCESSION BC103820 VERSION BC103820.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 766) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 766) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (07-SEP-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 5 Row: a Column: 16. FEATURES Location/Qualifiers source 1..766 /db_xref="H-InvDB:HIT000337372" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40000937" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: CGCACAAA sequenced from the reverse primer" gene 1..>766 /gene="TMEM185A" /db_xref="GeneID:84548" /db_xref="HGNC:HGNC:17125" /db_xref="MIM:300483" CDS 37..>766 /gene="TMEM185A" /codon_start=1 /product="TMEM185A protein" /protein_id="AAI03821.1" /db_xref="GeneID:84548" /db_xref="HGNC:HGNC:17125" /db_xref="MIM:300483" /translation="MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVF APIWLWKLMVIVGASVGTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVC DRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRL DKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWM TIVVPLLTFEILLVHKLDGHNGNTK" BASE COUNT 146 a 182 c 207 g 231 t ORIGIN 1 gaggaggagg aggacgccgc ggtgaagttc tccgccatga acctgagggg cctcttccag 61 gacttcaacc cgagtaaatt cctcatctat gcctgtctgc tgctgttctc tgtgctgctg 121 gcccttcgtt tggatggcat catacagtgg agttactggg ctgtctttgc tccaatatgg 181 ctgtggaagt taatggtcat tgttggagcc tcagttggaa ctggagtctg ggcacgaaat 241 cctcaatatc gagcagaagg agaaacgtgt gtggagttta aagccatgtt gattgcagtg 301 ggcatccact tgctcttgtt gatgtttgaa gttctggtct gtgacagaat cgagagagga 361 agccatttct ggctcctggt cttcatgccg ctgttctttg tttccccggt gtctgttgca 421 gcttgcgttt ggggctttcg acatgacagg tcactagagt tagaaatcct gtgttctgtc 481 aacattctcc agtttatatt cattgcctta agactggaca agatcatcca ctggccctgg 541 cttgttgtgt gtgtcccgct gtggattctc atgtcctttc tgtgcctggt ggtcctctac 601 tacattgtgt ggtccgtctt gttcttgcgc tctatggatg tgattgcgga gcagcgcagg 661 acacacataa ccatggccct gagctggatg accatcgtcg tgccccttct tacatttgag 721 attctgctgg ttcacaaact ggatggccac aacggcaaca ccaagc //