LOCUS       BC101213                 472 bp    mRNA    linear   HUM 10-APR-2007
DEFINITION  Homo sapiens chromosome 17 open reading frame 54, mRNA (cDNA clone
            IMAGE:40022035), partial cds.
ACCESSION   BC101213
VERSION     BC101213.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 472)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 472)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 7 Row: i Column: 9.
FEATURES             Location/Qualifiers
     source          1..472
                     /db_xref="H-InvDB:HIT000386340"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40022035"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: TGAACTAAAG sequenced from the reverse
                     primer"
     gene            1..>472
                     /gene="C17orf54"
                     /db_xref="GeneID:283982"
                     /db_xref="HGNC:HGNC:26863"
     CDS             71..>472
                     /gene="C17orf54"
                     /codon_start=1
                     /product="C17orf54 protein"
                     /protein_id="AAI01214.1"
                     /db_xref="GeneID:283982"
                     /db_xref="HGNC:HGNC:26863"
                     /translation="MTSSAPTLPDVTIRNVSRHIQMSLMGKGESPWLCRLQLEPLLQA
                     MEEQQLGNLEARWEVEKHGNEVSGSTSKSEPLPSSGNRGFLEETMHSPPPSVCAAVKT
                     DTRDSLEHVPSFHSHQPTAGTGAVHLFGSARS"
BASE COUNT          126 a          128 c          120 g           98 t
ORIGIN      
        1 gatcatcagg atggttgcac aatgttttga atgtaaatgc cactgaattg tacaccttaa
       61 aagggctcaa atgacatcat cagcacccac cctcccagat gtgacaatca gaaatgtgtc
      121 cagacatatc cagatgtccc ttatggggaa gggagaatcg ccctggcttt gcagactcca
      181 gctggaaccc ctgctgcaag cgatggagga gcaacagctc ggcaatctgg aggcaaggtg
      241 ggaggtggag aagcacggaa acgaagtctc tggctcaacc agcaaaagtg aaccactccc
      301 cagcagtgga aaccggggct tcctagaaga aacgatgcac tccccacctc cctctgtttg
      361 tgctgcagtg aaaactgaca cgagagattc attggaacat gtgccctcgt tccactctca
      421 tcagcccacc gcggggacag gagctgttca tctttttggc tctgctcgca gc
//