LOCUS BC101213 472 bp mRNA linear HUM 10-APR-2007 DEFINITION Homo sapiens chromosome 17 open reading frame 54, mRNA (cDNA clone IMAGE:40022035), partial cds. ACCESSION BC101213 VERSION BC101213.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 472) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 472) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 7 Row: i Column: 9. FEATURES Location/Qualifiers source 1..472 /db_xref="H-InvDB:HIT000386340" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40022035" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: TGAACTAAAG sequenced from the reverse primer" gene 1..>472 /gene="C17orf54" /db_xref="GeneID:283982" /db_xref="HGNC:HGNC:26863" CDS 71..>472 /gene="C17orf54" /codon_start=1 /product="C17orf54 protein" /protein_id="AAI01214.1" /db_xref="GeneID:283982" /db_xref="HGNC:HGNC:26863" /translation="MTSSAPTLPDVTIRNVSRHIQMSLMGKGESPWLCRLQLEPLLQA MEEQQLGNLEARWEVEKHGNEVSGSTSKSEPLPSSGNRGFLEETMHSPPPSVCAAVKT DTRDSLEHVPSFHSHQPTAGTGAVHLFGSARS" BASE COUNT 126 a 128 c 120 g 98 t ORIGIN 1 gatcatcagg atggttgcac aatgttttga atgtaaatgc cactgaattg tacaccttaa 61 aagggctcaa atgacatcat cagcacccac cctcccagat gtgacaatca gaaatgtgtc 121 cagacatatc cagatgtccc ttatggggaa gggagaatcg ccctggcttt gcagactcca 181 gctggaaccc ctgctgcaag cgatggagga gcaacagctc ggcaatctgg aggcaaggtg 241 ggaggtggag aagcacggaa acgaagtctc tggctcaacc agcaaaagtg aaccactccc 301 cagcagtgga aaccggggct tcctagaaga aacgatgcac tccccacctc cctctgtttg 361 tgctgcagtg aaaactgaca cgagagattc attggaacat gtgccctcgt tccactctca 421 tcagcccacc gcggggacag gagctgttca tctttttggc tctgctcgca gc //