LOCUS       BC101082                 538 bp    mRNA    linear   HUM 04-OCT-2006
DEFINITION  Homo sapiens zinc finger protein 365, mRNA (cDNA clone
            IMAGE:40009410), complete cds.
ACCESSION   BC101082
VERSION     BC101082.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 538)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 538)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 7 Row: g Column: 1
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..538
                     /db_xref="H-InvDB:HIT000336492"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40009410"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: GACACACT sequenced from the reverse primer"
     gene            1..538
                     /gene="ZNF365"
                     /gene_synonym="KIAA0844"
                     /gene_synonym="UAN"
                     /gene_synonym="ZNF365D"
                     /db_xref="GeneID:22891"
                     /db_xref="HGNC:HGNC:18194"
                     /db_xref="MIM:607818"
     CDS             154..351
                     /gene="ZNF365"
                     /gene_synonym="KIAA0844"
                     /gene_synonym="UAN"
                     /gene_synonym="ZNF365D"
                     /codon_start=1
                     /product="ZNF365 protein"
                     /protein_id="AAI01083.1"
                     /db_xref="GeneID:22891"
                     /db_xref="HGNC:HGNC:18194"
                     /db_xref="MIM:607818"
                     /translation="MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKDL
                     AKFGCYFPFVEGLFITMRRTS"
BASE COUNT          163 a          102 c          139 g          134 t
ORIGIN      
        1 ctgggtcaaa gggtgaagta gaaggaagct ggaaacacat agtattttag aagtttttca
       61 gagaaatcac aaggcaggaa cttctgctca gtttggaaga aagagcattc catcatgacc
      121 cttggactgg gtgagagcat catcctttaa ttaatgtctg cgctgggtca gataaccatc
      181 actgtctcca ggtgctggaa tacagagagg aaccaaacag ataaaaatcc ttgcctgcac
      241 ggagcttacc ttcagctaag ggagacagtc aaaaacaagg atttagccaa atttgggtgc
      301 tatttccctt ttgtggaggg acttttcatc acaatgagaa ggacgtctta ggactccagg
      361 actttgagag gcaaattgac aatcatcgat ttgttgactg aacacctgtt aggtgtaagg
      421 cacggtgtca tatgctttcc ttggggcttg ccttcaagca gctaacagaa ataagaagaa
      481 aacaggtgaa aaagacagtg tgataaggcc atggtggtgg attgtggatg ccctgccc
//