LOCUS BC101082 538 bp mRNA linear HUM 04-OCT-2006 DEFINITION Homo sapiens zinc finger protein 365, mRNA (cDNA clone IMAGE:40009410), complete cds. ACCESSION BC101082 VERSION BC101082.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 538) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 538) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 7 Row: g Column: 1 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..538 /db_xref="H-InvDB:HIT000336492" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40009410" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: GACACACT sequenced from the reverse primer" gene 1..538 /gene="ZNF365" /gene_synonym="KIAA0844" /gene_synonym="UAN" /gene_synonym="ZNF365D" /db_xref="GeneID:22891" /db_xref="HGNC:HGNC:18194" /db_xref="MIM:607818" CDS 154..351 /gene="ZNF365" /gene_synonym="KIAA0844" /gene_synonym="UAN" /gene_synonym="ZNF365D" /codon_start=1 /product="ZNF365 protein" /protein_id="AAI01083.1" /db_xref="GeneID:22891" /db_xref="HGNC:HGNC:18194" /db_xref="MIM:607818" /translation="MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKDL AKFGCYFPFVEGLFITMRRTS" BASE COUNT 163 a 102 c 139 g 134 t ORIGIN 1 ctgggtcaaa gggtgaagta gaaggaagct ggaaacacat agtattttag aagtttttca 61 gagaaatcac aaggcaggaa cttctgctca gtttggaaga aagagcattc catcatgacc 121 cttggactgg gtgagagcat catcctttaa ttaatgtctg cgctgggtca gataaccatc 181 actgtctcca ggtgctggaa tacagagagg aaccaaacag ataaaaatcc ttgcctgcac 241 ggagcttacc ttcagctaag ggagacagtc aaaaacaagg atttagccaa atttgggtgc 301 tatttccctt ttgtggaggg acttttcatc acaatgagaa ggacgtctta ggactccagg 361 actttgagag gcaaattgac aatcatcgat ttgttgactg aacacctgtt aggtgtaagg 421 cacggtgtca tatgctttcc ttggggcttg ccttcaagca gctaacagaa ataagaagaa 481 aacaggtgaa aaagacagtg tgataaggcc atggtggtgg attgtggatg ccctgccc //