LOCUS BC100910 560 bp mRNA linear HUM 03-NOV-2008 DEFINITION Homo sapiens torsin family 2, member A, mRNA (cDNA clone IMAGE:40003688), complete cds. ACCESSION BC100910 VERSION BC100910.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 560) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 560) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 5 Row: d Column: 18 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..560 /db_xref="H-InvDB:HIT000386326" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40003688" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_282" /note="Vector: pCR-Blunt II-TOPO; Clone identification sequence tag: TGACACC sequenced from the reverse primer" gene 1..560 /gene="TOR2A" /gene_synonym="TORP1" /db_xref="GeneID:27433" /db_xref="HGNC:HGNC:11996" /db_xref="MIM:608052" CDS 15..233 /gene="TOR2A" /gene_synonym="TORP1" /codon_start=1 /product="torsin family 2, member A" /protein_id="AAI00911.2" /db_xref="GeneID:27433" /db_xref="HGNC:HGNC:11996" /db_xref="MIM:608052" /translation="MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECD FRPDLPEGSEELGPREPHCLWPLPLPLR" BASE COUNT 83 a 183 c 162 g 132 t ORIGIN 1 aaaaaatcac ccggatggcg gctgcgacgc gcggctgccg gccctggggc tcgctcctcg 61 ggctgctcgg gctggtctcg gccgcggccg ccgcctggga cctggcttcc ctgcgctgca 121 ccttgggcgc cttttgcgaa tgcgacttcc ggcccgactt gccggaagga tctgaagagc 181 tgggtccaag ggaacctcac tgcctgtggc cgctccctct tcctcttcga tgagatggac 241 aagatgcccc caggcctgat ggaagtcctg cggcctttcc tgggctcctc ctgggtggta 301 tacgggacca attaccgcaa agccatcttc atcttcatca ggtggggccc ggctttgcag 361 tgggcacagt gcgggggcca cttctcagag gttcagctct gcagccttag cctgtgctcc 421 cagcagaatc cagttcccca tgggcttagc tgggctttcc cagtgccctc cgccactctc 481 agagatgaca ttgtcattcc gcctggttga tttccctttg gacattctca gcaaattctg 541 ggctcagtct ttttgatcgc //