LOCUS       BC100910                 560 bp    mRNA    linear   HUM 03-NOV-2008
DEFINITION  Homo sapiens torsin family 2, member A, mRNA (cDNA clone
            IMAGE:40003688), complete cds.
ACCESSION   BC100910
VERSION     BC100910.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 560)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 560)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Baylor Human Genome Sequencing Center
            cDNA Library Preparation: Baylor Human Genome Sequencing Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAM Plate: 5 Row: d Column: 18
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..560
                     /db_xref="H-InvDB:HIT000386326"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40003688"
                     /tissue_type="PCR rescued clones"
                     /clone_lib="NIH_MGC_282"
                     /note="Vector: pCR-Blunt II-TOPO; Clone identification
                     sequence tag: TGACACC sequenced from the reverse primer"
     gene            1..560
                     /gene="TOR2A"
                     /gene_synonym="TORP1"
                     /db_xref="GeneID:27433"
                     /db_xref="HGNC:HGNC:11996"
                     /db_xref="MIM:608052"
     CDS             15..233
                     /gene="TOR2A"
                     /gene_synonym="TORP1"
                     /codon_start=1
                     /product="torsin family 2, member A"
                     /protein_id="AAI00911.2"
                     /db_xref="GeneID:27433"
                     /db_xref="HGNC:HGNC:11996"
                     /db_xref="MIM:608052"
                     /translation="MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECD
                     FRPDLPEGSEELGPREPHCLWPLPLPLR"
BASE COUNT           83 a          183 c          162 g          132 t
ORIGIN      
        1 aaaaaatcac ccggatggcg gctgcgacgc gcggctgccg gccctggggc tcgctcctcg
       61 ggctgctcgg gctggtctcg gccgcggccg ccgcctggga cctggcttcc ctgcgctgca
      121 ccttgggcgc cttttgcgaa tgcgacttcc ggcccgactt gccggaagga tctgaagagc
      181 tgggtccaag ggaacctcac tgcctgtggc cgctccctct tcctcttcga tgagatggac
      241 aagatgcccc caggcctgat ggaagtcctg cggcctttcc tgggctcctc ctgggtggta
      301 tacgggacca attaccgcaa agccatcttc atcttcatca ggtggggccc ggctttgcag
      361 tgggcacagt gcgggggcca cttctcagag gttcagctct gcagccttag cctgtgctcc
      421 cagcagaatc cagttcccca tgggcttagc tgggctttcc cagtgccctc cgccactctc
      481 agagatgaca ttgtcattcc gcctggttga tttccctttg gacattctca gcaaattctg
      541 ggctcagtct ttttgatcgc
//